KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01380Help
Entry
CLIBASIA_01380    CDS       T00948                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:las00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:las00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:las03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:las03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:las03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(290437..290862)
Genome map
AA seq 141 aa AA seqDB search
MRTLLFYRFKNDWEYNLLVLLQDEYEKGKRVSVQCGSERVRDSLNEYLWTWKKDGFLPHG
VDVGDEGDFSSFQPVLLTISSLNANTSTIRFLVDEASMHIGDVDYYEKVVFIINTDDQGS
LEWGRAHWRSLKNSGYAPDVI
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgagaactcttcttttttatcgcttcaaaaacgattgggagtataacctcctagttttg
ttgcaagatgagtatgaaaaaggtaaaagggtctctgttcaatgtgggtctgaaagggta
cgtgattcattaaatgagtacttgtggacgtggaaaaaagatggttttcttcctcatggt
gtagatgtgggagatgagggggatttttcttcttttcaaccagttttgctgacgataagc
tctttgaatgctaatacctctactatacggtttcttgtagatgaggcttccatgcatata
ggggatgtagattattacgagaaggtagtttttattataaacactgatgatcaggggagt
cttgaatgggggcgtgcacattggcgaagccttaaaaatagtggatatgcgccagatgtt
atatga

DBGET integrated database retrieval system