KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01380Help
Entry
CLIBASIA_01380    CDS       T00948                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:las00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CLIBASIA_01380
   00240 Pyrimidine metabolism
    CLIBASIA_01380
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CLIBASIA_01380
   03430 Mismatch repair
    CLIBASIA_01380
   03440 Homologous recombination
    CLIBASIA_01380
Enzymes [BR:las01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CLIBASIA_01380
DNA replication proteins [BR:las03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CLIBASIA_01380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(290437..290862)
Genome map
AA seq 141 aa AA seqDB search
MRTLLFYRFKNDWEYNLLVLLQDEYEKGKRVSVQCGSERVRDSLNEYLWTWKKDGFLPHG
VDVGDEGDFSSFQPVLLTISSLNANTSTIRFLVDEASMHIGDVDYYEKVVFIINTDDQGS
LEWGRAHWRSLKNSGYAPDVI
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgagaactcttcttttttatcgcttcaaaaacgattgggagtataacctcctagttttg
ttgcaagatgagtatgaaaaaggtaaaagggtctctgttcaatgtgggtctgaaagggta
cgtgattcattaaatgagtacttgtggacgtggaaaaaagatggttttcttcctcatggt
gtagatgtgggagatgagggggatttttcttcttttcaaccagttttgctgacgataagc
tctttgaatgctaatacctctactatacggtttcttgtagatgaggcttccatgcatata
ggggatgtagattattacgagaaggtagtttttattataaacactgatgatcaggggagt
cttgaatgggggcgtgcacattggcgaagccttaaaaatagtggatatgcgccagatgtt
atatga

DBGET integrated database retrieval system