KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02705Help
Entry
CLIBASIA_02705    CDS       T00948                                 

Definition
glyceraldehyde 3-phosphate Dehydrogenase
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:las00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLIBASIA_02705
   01230 Biosynthesis of amino acids
    CLIBASIA_02705
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLIBASIA_02705
Enzymes [BR:las01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     CLIBASIA_02705
Exosome [BR:las04147]
 Exosomal proteins
  Proteins found in most exosomes
   CLIBASIA_02705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
617585..618586
Genome map
AA seq 333 aa AA seqDB search
MVCKVAINGFGRIGRCILRAAVESRRDDVRIVAINDLNSIETMAHLLRYDSVHGRFPGEV
KIIGDTIDVGLGPIQVTSIRDPQDLPWGDVDVAMECTGFFVTQEKASLHLSNGSQRVLVS
APCKGVKKTIVYGVNHQSLNKEDKVVSNASCTTNCLVPVVHVLDKMFGIEKGYMTTVHSY
TGDQHVLDAGHSDLYRSRAAAISMVPTSTGAAKAVELVLPNLKGKLDGSSIRVPTPNVSM
VDLKCVTSRDVNIDEINATMKYFAEGDLKNILGYVTLPLVSVDFNHTSYSSIFAADQTKV
VSQNLLRVLVWYDNEWGFSNRMLDTASAMANLS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggtttgcaaagttgctataaatggttttggtcgtattggacgatgtattcttcgcgct
gcagttgagtcaagacgcgatgatgtgagaattgtagcgattaatgatcttaattctata
gagacaatggctcatttattgcggtacgattcggtacatggaaggtttccaggagaggtg
aaaatcataggcgataccatagatgttggtttgggacctatacaagtcactagtattcgc
gatccgcaggatcttccatggggtgatgttgatgtagctatggaatgtacaggttttttt
gtaacgcaagaaaaagcttcgcttcatttatctaatggttctcagcgtgttttagtatct
gcgccgtgtaaaggagtcaaaaagactatcgtttacggtgtcaatcatcaatcgttaaat
aaagaggataaagttgtttccaatgcttcttgcaccactaattgtttggttccagtggtc
catgttttagataaaatgtttgggattgaaaaaggatatatgacgactgttcattcttat
acaggtgatcagcacgttctagatgcgggacatagtgatctttatcgttcacgagcagca
gctatatcgatggttcctacctcgactggcgcagccaaagctgtagagctagttttgccg
aatctcaaaggtaaattagacggttcgtccattcgagttcccacgcctaatgtatcgatg
gtggatttaaaatgtgtaacaagtcgtgatgtgaatattgacgaaatcaatgcaacgatg
aaatattttgccgaaggagatttaaaaaatattctgggctatgtcactcttccattggtt
tctgtagactttaatcatacgtcttattcatccatatttgcagctgatcagacaaaagta
gtttctcagaatcttcttcgtgtactggtttggtatgataatgagtggggtttttccaat
cgtatgttggataccgcatcagcaatggctaatctctcatag

DBGET integrated database retrieval system