KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02705Help
Entry
CLIBASIA_02705    CDS       T00948                                 

Definition
glyceraldehyde 3-phosphate Dehydrogenase
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:las01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:las01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:las00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
617585..618586
Genome map
AA seq 333 aa AA seqDB search
MVCKVAINGFGRIGRCILRAAVESRRDDVRIVAINDLNSIETMAHLLRYDSVHGRFPGEV
KIIGDTIDVGLGPIQVTSIRDPQDLPWGDVDVAMECTGFFVTQEKASLHLSNGSQRVLVS
APCKGVKKTIVYGVNHQSLNKEDKVVSNASCTTNCLVPVVHVLDKMFGIEKGYMTTVHSY
TGDQHVLDAGHSDLYRSRAAAISMVPTSTGAAKAVELVLPNLKGKLDGSSIRVPTPNVSM
VDLKCVTSRDVNIDEINATMKYFAEGDLKNILGYVTLPLVSVDFNHTSYSSIFAADQTKV
VSQNLLRVLVWYDNEWGFSNRMLDTASAMANLS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggtttgcaaagttgctataaatggttttggtcgtattggacgatgtattcttcgcgct
gcagttgagtcaagacgcgatgatgtgagaattgtagcgattaatgatcttaattctata
gagacaatggctcatttattgcggtacgattcggtacatggaaggtttccaggagaggtg
aaaatcataggcgataccatagatgttggtttgggacctatacaagtcactagtattcgc
gatccgcaggatcttccatggggtgatgttgatgtagctatggaatgtacaggttttttt
gtaacgcaagaaaaagcttcgcttcatttatctaatggttctcagcgtgttttagtatct
gcgccgtgtaaaggagtcaaaaagactatcgtttacggtgtcaatcatcaatcgttaaat
aaagaggataaagttgtttccaatgcttcttgcaccactaattgtttggttccagtggtc
catgttttagataaaatgtttgggattgaaaaaggatatatgacgactgttcattcttat
acaggtgatcagcacgttctagatgcgggacatagtgatctttatcgttcacgagcagca
gctatatcgatggttcctacctcgactggcgcagccaaagctgtagagctagttttgccg
aatctcaaaggtaaattagacggttcgtccattcgagttcccacgcctaatgtatcgatg
gtggatttaaaatgtgtaacaagtcgtgatgtgaatattgacgaaatcaatgcaacgatg
aaatattttgccgaaggagatttaaaaaatattctgggctatgtcactcttccattggtt
tctgtagactttaatcatacgtcttattcatccatatttgcagctgatcagacaaaagta
gtttctcagaatcttcttcgtgtactggtttggtatgataatgagtggggtttttccaat
cgtatgttggataccgcatcagcaatggctaatctctcatag

DBGET integrated database retrieval system