KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_03255Help
Entry
CLIBASIA_03255    CDS       T00948                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:las00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CLIBASIA_03255 (recR)
DNA repair and recombination proteins [BR:las03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CLIBASIA_03255 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
501676..502281
Genome map
AA seq 201 aa AA seqDB search
MQKKITGKEIENLIKILARIPGFGPRSARRATLHLVKKKEQLLGPLAEAMANIYNKVCLC
SICGNVDTTDPCAICIDQQRDASVIIVVEDVADLWALERSKAVNALYHVLGGSLSPLDRI
GPEDIGIQSLIERIEVKKIRELIFAISATIEGQTTAHYIMDKLKGIDVKITRLAYGIPMG
SELDYLDDGTIFEAIRSRTVL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaaaataacagggaaagaaattgaaaatctcattaaaatattagcgcgtata
ccgggttttggtcctcgttctgcgaggagagcgactttacatttggtcaagaaaaaggaa
caattattgggtcctttagcagaggctatggccaacatatacaataaagtctgtctctgt
tctatttgtgggaatgttgatactacagatccttgtgctatttgtatagatcaacagcgg
gatgcctcagtgattatagtagtagaagatgttgctgatttatgggctttagagcgctct
aaagcagtaaatgctctataccatgtgctaggtggatccctttctccgcttgatagaatt
ggtccagaagatattggaatacagtctttgatagagagaatcgaagttaaaaaaattcga
gaactgatttttgccattagtgctacaattgaagggcaaacgacagcccattacattatg
gacaaacttaaaggaatagatgttaaaattaccagattggcttatggtattcctatgggg
agtgaattagattacctcgatgatgggactatttttgaagccattcgttctcgaactgtt
ttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system