KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04045Help
Entry
CLIBASIA_04045    CDS       T00948                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00230  Purine metabolism
las01100  Metabolic pathways
Module
las_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:las00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CLIBASIA_04045 (gmk)
Enzymes [BR:las01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CLIBASIA_04045 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_22 AAA_16 RsgA_GTPase CbiA
Motif
Other DBs
NCBI-ProteinID: ACT57383
UniProt: C6XG80
Position
888015..888683
Genome map
AA seq 222 aa AA seqDB search
MNRDRLFPLTVNHRGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDG
KDYYFLSLSRFNELKKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNL
HKQMGSNVLSFFILPPTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVL
INDDLENSLSILKSVIEVERIRRHRLKNGIGGFVGKLLKEEL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgagatcgtctctttcctctgactgttaatcatcgaggaatgatgttaattatt
tcttctccttctggagttggcaagtctacgatagcacgtcatctccttaaatgtgatcag
aattttgagatgtcaattagtgtcactacacgtgttcgccgtccaaatgaagtagatggt
aaggattattattttttaagtcttagtagatttaatgagttgaaaaaggctaatgctttt
atagagaaggcagaggtgcatggtaatttttatggcactttgcgtgatcctatagaagaa
actatatctaagggtaaggatatgctctttgatattgattggcaaggagcgcagaatctg
cataagcagatgggctcgaatgttctgtcgttttttattttgcctccgacaatgcaagaa
ctgtgttctcgtttgagtttacgtgcgaaaaaaaatcaagaagataaggaaaaggtgcaa
ttacgattgcagaatgcttattcggaaataaaaaaatgggaattttatgattatgttctg
atcaacgatgatttagaaaattctctcagcatattaaaatctgtcattgaagttgagaga
atacgccgtcatcgtcttaaaaatggtatcggtggattcgtgggaaaattattaaaagag
gagttatga

DBGET integrated database retrieval system