KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04720Help
Entry
CLIBASIA_04720    CDS       T00948                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:las00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLIBASIA_04720 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLIBASIA_04720 (sdhD)
   00650 Butanoate metabolism
    CLIBASIA_04720 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    CLIBASIA_04720 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1044471..1044863
Genome map
AA seq 130 aa AA seqDB search
MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV
LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS
LLKIAILGTL
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
ttggattttgatatgcgtagtagtttgggaagagtgcggggcatgggctctgctaaggat
ggtacggggcattttataaaacaaagattcactgctattgctaatattccctttattatt
ttttttattgctttttttataaaatatggtgatgctccatatgagcagattgtttctgtg
ctttctaatgtggccgtagcatctatcatgggattaggaacaatttcgatttctgtgcat
atgcaacttggtatgcaagtaataattgaagattatattcattatagactattgaaaata
atgttcctttttatgaatagttgttttgttttattgcttattattttttgtctgttctct
ctcttaaaaattgcaattttgggtactctatga

DBGET integrated database retrieval system