KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04720Help
Entry
CLIBASIA_04720    CDS       T00948                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00020  Citrate cycle (TCA cycle)
las00190  Oxidative phosphorylation
las00650  Butanoate metabolism
las01100  Metabolic pathways
las01110  Biosynthesis of secondary metabolites
las01120  Microbial metabolism in diverse environments
las01130  Biosynthesis of antibiotics
las01200  Carbon metabolism
Module
las_M00009  Citrate cycle (TCA cycle, Krebs cycle)
las_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
las_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:las00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLIBASIA_04720 (sdhD)
   00650 Butanoate metabolism
    CLIBASIA_04720 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    CLIBASIA_04720 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt UPF0121 CybS
Motif
Other DBs
NCBI-ProteinID: ACT57515
UniProt: C6XGL2
Position
1044471..1044863
Genome map
AA seq 130 aa AA seqDB search
MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSV
LSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFS
LLKIAILGTL
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
ttggattttgatatgcgtagtagtttgggaagagtgcggggcatgggctctgctaaggat
ggtacggggcattttataaaacaaagattcactgctattgctaatattccctttattatt
ttttttattgctttttttataaaatatggtgatgctccatatgagcagattgtttctgtg
ctttctaatgtggccgtagcatctatcatgggattaggaacaatttcgatttctgtgcat
atgcaacttggtatgcaagtaataattgaagattatattcattatagactattgaaaata
atgttcctttttatgaatagttgttttgttttattgcttattattttttgtctgttctct
ctcttaaaaattgcaattttgggtactctatga

DBGET integrated database retrieval system