KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04770Help
Entry
CLIBASIA_04770    CDS       T00948                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00020  Citrate cycle (TCA cycle)
las00310  Lysine degradation
las01100  Metabolic pathways
las01110  Biosynthesis of secondary metabolites
las01120  Microbial metabolism in diverse environments
las01130  Biosynthesis of antibiotics
las01200  Carbon metabolism
Module
las_M00009  Citrate cycle (TCA cycle, Krebs cycle)
las_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:las00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLIBASIA_04770 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CLIBASIA_04770 (sucB)
Enzymes [BR:las01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CLIBASIA_04770 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 SAPS YajC
Motif
Other DBs
NCBI-ProteinID: ACT57525
UniProt: C6XGM2
Position
1055786..1057096
Genome map
AA seq 436 aa AA seqDB search
MLTGIINNTGILEEKVRSMATKILVPSLGESVNEATVGTWLKEIGESVEIGEILVELETD
KVTVEVPSPVSGKLHEMSVAKGDTVTYGGFLGYIVEIARDEDESIKQNSPNSTANGLPEI
TDQGFQMPHSPSASKLIAESGLSPSDIKGTGKRGQILKSDVMAAISRSESSVDQSTVDSH
KKGVFSRIINSASNIFEKSSVSEELSEERVKMSRLRQTVAKRLKDAQNTAAILSTYNEVN
MSRIISIRSRYKDIFEKKHGIKLGFMGFFTKAASHVLQEIKGVNAEIDGDHIVYKNYCHI
GVAVGTDKGLVVPVIRHADKMNIVEIEREIARLGREARAGHLSMRDLQNGTFTISNGGVY
GSLLSSPILNPPQSGILGMHKIQERPIVEDGQIVIRPMMYLALSYDHRIVDGKEAVTFLV
RLKELLEDPERFILDL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccggtattattaataataccggtattttggaagagaaagttagaagtatggct
acgaaaattctagtgccctctctgggcgaatctgtcaatgaagcaacggttggcacttgg
cttaaagaaattggtgaatcagttgaaatcggtgaaattttagtagaactcgaaaccgat
aaggtgaccgttgaagtgccttctcctgtctcgggaaaattgcacgagatgtctgttgca
aaaggcgatacagttacttatgggggatttttaggatatattgtagaaattgcaagagat
gaagatgaatctataaagcaaaattctcctaattctactgccaatggtttacctgaaata
actgatcaaggttttcaaatgccacactccccatctgcttctaaattaatagcagaatcc
ggtttatctccttctgatattaagggaacgggcaaaagagggcagatattgaaatctgat
gttatggcagcaatttctcgttccgaatcttctgttgatcaatcaaccgttgactctcat
aaaaaaggtgttttttcgagaattattaatagtgcctctaatatttttgaaaaatcaagc
gtttccgaagaattatctgaagagcgtgtcaaaatgtctcgtttgcgtcaaactgttgct
aaacgattaaaagatgctcaaaatactgcagctattttgagtacgtataatgaagtcaat
atgtctcgtattatttctatccgatctcgttataaagatatttttgagaaaaagcatggg
attaagctaggttttatgggcttttttaccaaagcagcaagtcacgttctgcaagaaatt
aaaggtgtcaatgcagaaattgatggcgatcatattgtttataaaaattactgccatatt
ggagtggcagtgggcacagataaaggtcttgtagtaccggttatacgtcatgcggataaa
atgaatattgtggagattgaaagagagattgcgcgtcttggtcgagaagctcgtgcagga
catctttctatgcgtgatttgcaaaatggtacatttactatatctaatggtggagtctat
ggttctcttttatcttctccaatattaaatccgccacaatcgggtattctgggtatgcat
aaaattcaggaaagaccaatagtagaggatggacaaatcgtgattcgtcctatgatgtat
ctcgctttatcatatgatcatcgtatagtcgatggaaaagaggctgtaacatttttggtt
cgtttgaaagaattgcttgaagatcctgaacgttttatattggacttatag

DBGET integrated database retrieval system