KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04790Help
Entry
CLIBASIA_04790    CDS       T00948                                 

Definition
phage-related lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
Enzymes [BR:las01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     CLIBASIA_04790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1061333..1061848
Genome map
AA seq 171 aa AA seqDB search
MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYG
HTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIG
NYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtattataaacagaataatatcatttgtgaaaaggatgataggcatgaacggtgat
gataaacataataaaataccagttcctaacgctcttattaaaatgctcaaggagttcgag
ggccttagactaacagcttatcgtgatatcggaggtggtgcttggacaattggctatggg
catactggctcagatgttacagagggtatgacgattacagaaaaagaagcagaagatttt
ttgctgaaagatgcgagtaagtctcttaatttacttttagagtcatctccggctttaaag
tcaactagtgaaaatcgcttggtcgcagtagctgatttcgtgtttaatcttggtatcgga
aattataataaaagcacttttaaacaacgtgttgatgctcaagattgggaaaaagccgct
gaggaatgtaaaaaatggactaaggcgggtggaaaggttttgccgggccttgtaaaaagg
cgtgatgcagaggttaagttattgttagaaagttga

DBGET integrated database retrieval system