KEGG   Loxodonta africana (African savanna elephant): 100670049Help
Entry
100670049         CDS       T04351                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100670049 (ABHD12)
Peptidases [BR:lav01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100670049 (ABHD12)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100670049 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 366 aa AA seqDB search
MVSSSQNLRLPGAGAAEPRCAADAGMKRALGRRKGLWLRLRKILLCVLGLYVAIPFLVKL
CPGIQAKLIFLNFVRIPYFIDLKKPQDQGLNHTCNYYLQPEEDVTIGVWHTVPAVWWRNA
QGKDQMWYEDTLASNHPIVLYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSA
GTPSEQGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILE
SPFTNIREEAKSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENVKHISCSLLILHAED
DPVVPFQLGRKLYNIAAPSRSFRDFKVQFIPFHSDLGYRHKYIYKSPELPRILREFLGKS
EQERHH
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggtatcgagctcccagaacctgcgtctgccgggcgcgggggcggccgagccgcggtgc
gcggccgacgcgggcatgaagcgggctctgggcaggcggaagggtctgtggctccgactg
aggaagatacttctctgtgttttggggttgtacgttgccattccatttcttgtcaaactg
tgtcctggaatacaggccaaactgattttcttgaattttgtgaggattccctatttcatt
gacttgaagaagcctcaggatcaaggcttgaatcacacctgtaattattacctccagcca
gaggaagacgtgacaataggtgtctggcacaccgtcccagctgtctggtggaggaacgcc
caaggaaaggaccagatgtggtatgaggacaccttggcttctaaccaccctatcgttctg
tatctgcatggcaatgcgggcactaggggaggggaccaccgtgtggagctgtacaaggtg
ctgagttcccttggttaccatgttgtcacctttgattacagaggttggggtgactcagca
ggaacgccgtctgagcagggcatgacgtatgatgcactccacgtttttgactggatcaaa
gcaagaagtggtgacaacccggtatatatttggggacactccctgggcaccggggttgca
acaaatttggtgcggcgcctttgcgagcgagagacaccaccagatgcactgatattggaa
tctccattcaccaatatccgtgaagaagcaaaaagccatccgttttcagtgatatatcga
tacttccctggatttgactggtttttcctcgatcctattacaagcagtggaattaaattt
gccaacgatgagaatgtgaagcacatctcctgctccctgcttattctccatgcagaggac
gacccagtcgtgcccttccagctcggcagaaagctctacaacatcgctgcaccatctcga
agcttccgggacttcaaagttcagttcatcccctttcattcggaccttggctacaggcac
aagtacatctataagagccccgagcttccacggatactgagggagtttctggggaaatcg
gagcaggaacgtcaccactga

DBGET integrated database retrieval system