KEGG   Loxodonta africana (African savanna elephant): 100671842Help
Entry
100671842         CDS       T04351                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform X1
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
Glycerolipid metabolism
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:lav00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100671842 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100671842 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    100671842 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    100671842 (MGLL)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100671842 (MGLL)
Peptidases [BR:lav01002]
 Serine Peptidases
  Family S33
   100671842 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 319 aa AA seqDB search
MQTQDTMETGLANPFRMPEESSPRGTPQSAPYQDLPHLINADGQRLFCKYWKPTGEPKAL
VFVSHGAGEHCGRYEELAQMLTGLGLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHV
DVMQRDYPRLPVFLLGHSMGGAISILTAAERPGHFSGMVLISPLVLANPESATTFKVLVA
KVLNFVLPNMSLGPIDSSVLSRNKTEVDLYNADPLICRAGLKVSFGIQLLNAVSRVERAL
PKLTLPFLLLQGSADRLCDSRGAYLLMEQAKSQDKTLKIYEGAYHVLHKELPEVTNSVFQ
EINVWVSQRTAAVGAGSPP
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacccaggacacgatggaaacaggacttgcaaatcctttcagaatgccggaggaa
agttctcccagggggaccccacagagtgctccataccaggacctccctcacctgattaac
gctgacgggcagcgccttttctgcaagtactggaaacccacaggcgagcccaaggcactg
gtgtttgtttcccatggagccggggagcactgcggccgctatgaggaactggctcagatg
ctgacgggactgggcctgctggtgttcgcccacgaccatgttggccacggacagagtgaa
ggggagaggatggtggtgtctgacttccacgttttcgtcagggatgtgttacagcacgtg
gatgtcatgcagagagactaccccaggcttcctgtcttccttctgggtcactccatggga
ggtgccatctccatcctcactgccgcagaaaggccaggccacttctccggcatggttctc
atctcacccttggttctcgccaatccggagtcggccacaactttcaaggtccttgttgcg
aaagtgctcaactttgtcctgcccaacatgtccctggggcccatcgattccagcgtgctc
tctcggaataagacagaggtggacctgtacaatgcagacccgctgatctgccgggcaggg
ctgaaggtgtcctttggcatccagctgctcaacgccgtctcccgggtggagcgtgccctc
cccaagctgaccctgcccttcctgctgctccagggctctgcggaccgcctgtgtgatagc
aggggagcctacctgctcatggagcaagccaagagccaggataagacgctcaagatctat
gaaggtgcctaccatgttctccacaaagagcttcctgaagtaaccaactccgtcttccag
gaaataaacgtgtgggtctctcaaaggacagctgcagtaggagccgggtccccaccctga

DBGET integrated database retrieval system