KEGG   Lactobacillus amylovorus GRL1118: LAB52_01655Help
Entry
LAB52_01655       CDS       T01954                                 

Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:lay01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lay01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lay00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:lay00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lay00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
319296..319973
Genome map
AA seq 225 aa AA seqDB search
MAKLVLVRHGESVANAANVYTGWNDVPLTHKGEEQAKQAGELINTISDFAPTHIHTSVLS
RAITTANIVADTCNLLWLPITKTWRLNERHYGALRGLNKDISRKVFGVEQVLLWRRGFDS
VPPAQGSPMIDRRYKLCDQHLMPRAESLHQTQKRLMPYYYDHIASRLLNGEDQLIVAHGS
SLRALIKKLENINDHDIVNLEVPNAEPIVYTMDDQLNIVDKKILH
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattagtattagttcgacatggcgaaagtgttgccaatgccgcaaatgtttat
actggatggaacgatgttccattgactcacaagggtgaggagcaggctaagcaggcaggc
gaattaattaatactatctcagactttgctccaacgcatatccatacttcagtcttgtcg
cgtgctattacgacagccaatattgtcgccgatacatgtaatttgttatggctcccgatc
actaagacgtggcgactaaatgaacgtcactacggggctctacgtggccttaacaaggat
atctcgcgtaaagtattcggtgtagaacaagttttactctggcgtagaggttttgattcc
gttccacctgctcaaggttcgccaatgattgatcgtcgctataaattatgcgatcaacat
ttgatgccacgagcagaaagtttacatcaaacccaaaaacgtttgatgccatattactat
gatcatattgcttcgagattgttaaatggtgaagaccaattaatcgtagctcatggttca
agtcttcgtgctttgattaaaaagcttgaaaacattaatgatcatgacattgttaacctt
gaagtacctaatgcagaaccaattgtttatacgatggatgatcagttaaatattgttgat
aaaaagattttacattaa

DBGET integrated database retrieval system