KEGG   Lactobacillus amylovorus GRL1118: LAB52_01850Help
Entry
LAB52_01850       CDS       T01954                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lay03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
351407..352006
Genome map
AA seq 199 aa AA seqDB search
MQYPLPIAHLIDAYMKLPGIGEKTATRLAFYTMDMPQEDVEDFARALIQVKKDIHQCPIC
GNITEKDICDICSNPNRDQTTIMVVEQPKDVMSFEEMGEYSGLYHVLHGVLSPMDGIGPE
EINIKSLITRLQKHDEVKEVILALNSTPEGESTAMYISKLIKPAGIKVTRLAAGLSVGSD
IEYANSITLKRAVQGRTTL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatatccattaccaatagctcatttaattgatgcttatatgaaacttccaggcatt
ggtgaaaagaccgccactagattggctttttacacaatggatatgccgcaagaagatgtg
gaagattttgctagagcattaattcaagtgaaaaaagatatccatcaatgtccaatttgt
ggcaatattaccgaaaaagatatctgtgatatttgttctaaccctaatcgtgatcaaaca
acgattatggtggttgaacagcctaaagatgtaatgtcttttgaagagatgggtgaatac
agcggtttgtatcatgtgcttcacggcgtattatcaccaatggatggaattggtccagaa
gaaatcaacattaaatctttaattactcgtttgcaaaagcatgacgaagttaaagaagtg
attttagctcttaattcgactcctgagggtgaatcaaccgcaatgtacatcagcaaattg
atcaaaccagctggtattaaagttactcgcttagctgcaggtttatctgtaggtagcgat
atcgaatatgccaattcaattactttgaaacgggcagtacaaggaagaacgactctataa

DBGET integrated database retrieval system