KEGG   Lactobacillus amylovorus GRL1118: LAB52_02005Help
Entry
LAB52_02005       CDS       T01954                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lay03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
382554..383141
Genome map
AA seq 195 aa AA seqDB search
MYEYFEGIISVITPSYIVVDVNGVGYKVYSPTPFAYTQGQKAKVYIEQVVRDTGITLYGF
QSQDDKGLFLKLLSVSGIGPKSAMAIMAAEDSNSLAEAIEQGEVKYLTRFPGVGKKTASQ
IVLDLKGKLGDYVARLDRKDNDEEISPALNDALLALIALGYTQKEVDRITPKLIEVDADT
ADQYIKKGLALLLKK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaatattttgaaggaataatttccgtcattacgccaagctatatcgtagtagat
gttaacggagtgggctataaggtgtatagtccaacgccatttgcttatactcaaggacaa
aaggccaaggtttatatcgaacaagttgtgcgtgataccggcattactttatatggtttc
cagagtcaagatgacaaaggacttttccttaagttgcttagtgtaagcggcattggtcct
aagagtgccatggcaattatggcagccgaagacagcaattccttagctgaagcaattgaa
caaggtgaagttaaatacttaactcgcttccctggtgtgggcaaaaagaccgcctcacag
attgtgcttgatctaaaggggaagttaggcgactacgttgctcgtcttgatcgtaaggat
aacgatgaagaaatttctccagcattaaatgatgcattattagcattaattgctttgggc
tatacccaaaaagaagttgaccgcattacgcctaagttaatcgaggtcgatgccgataca
gcagatcaatatattaaaaaaggtttagcattgctgcttaagaagtag

DBGET integrated database retrieval system