KEGG   Lactobacillus amylovorus GRL1118: LAB52_02255Help
Entry
LAB52_02255       CDS       T01954                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lay00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LAB52_02255
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAB52_02255
   00620 Pyruvate metabolism
    LAB52_02255
   00650 Butanoate metabolism
    LAB52_02255
  Lipid metabolism
   00071 Fatty acid degradation
    LAB52_02255
  Amino acid metabolism
   00350 Tyrosine metabolism
    LAB52_02255
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LAB52_02255
   00626 Naphthalene degradation
    LAB52_02255
Enzymes [BR:lay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LAB52_02255
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LAB52_02255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
442764..445391
Genome map
AA seq 875 aa AA seqDB search
MAKTQQKQTLTEEEKKKQIYDMVDNLVKKSHVALDQMANFTQEQVDKICEAVATAGEQNA
YPLAKMAVEETKRGVVEDKTTKNMYASENIWNSLRHEKTVGVIEEDKELGLTKIAEPKGV
IAGVTPVTNPTSTVIFKAMLALKTRNTIIFGFHPQAQKCCVETGKIIRAAAVAAGAPADA
VQWIEEPSLDATTDLMNNPGVQTILATGGPGMVKAAYSSGKPAIGVGPGNGPSYIEKSAN
IDRAVYDIVLSKNFDNGMVCASENSVVVDDEIYDKVVDEFKKWDCYFLNKEEIKKFEEHF
IDPRRGTVAGPVAGKSAYEIAKLCGVDVPKNTKVIVAEYNGVGRKFPLSAEKLSPVFTLY
RAKNHDDAFRICSELLDYGGRGHTAGLHSSDKKIIDEFAMKMDACRILVNSPAALGGIGD
LYNNMLPSLTLGTGSYGANTFSHNIGAKDLLNIKTVAMRRDNMQWVKVPSKTYFEHNAAN
YLRHMPNVNRFFIVTDEGVADEGFADEITDIISKRRGQKEYEVFKAVTLDPNTDVIKDGV
HRMNIFKPDVVIAIGGGSVMDAAKAMRLFYENPEMSFEEAYQKFLDIRKRVVRFPKINGV
QLVCIPTTSGTGSEVSPIAIISDAKTGIKHTLCDYALTPDVSIVDDQFVQEMPKRLIAWS
GFEALGHAIESYVSTMATDFTRGWSLEAIKIIFANLKNSYDGNLAARKQMHDAATIAGMA
YSNAFLGLEHSIAHTVGSTFDIPSGVSDAIALPQVIRFNSKRPEKLAMWPHYSVYRADTD
YADIAKAIGLTGSSKEELIEGLVQKIIDLAQSVGIKMAYKDYGVDKAEFDKKVDELAVEA
YGDQNTVTNPSAPLISEIAQLMRDSYEGKNTSINK
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggctaagacacaacaaaaacagactcttacagaggaagaaaagaaaaagcaaatctac
gacatggtagataacttagtaaagaaatcacatgttgcattagaccaaatggctaacttc
acacaagaacaagttgataagatctgtgaagcagttgctactgccggtgaacaaaatgct
tatccattggctaaaatggccgttgaagaaactaagcgtggtgtggtagaagacaaaact
actaagaatatgtacgctagtgaaaatatttggaatagtttacgtcacgaaaagactgtt
ggcgtaattgaggaagacaaggaattaggtttaaccaagattgctgaacctaagggtgtc
attgctggtgttactccagtaactaacccaacttcaactgttatttttaaagctatgctt
gctttaaagactagaaatacaattatcttcggcttccacccacaagctcaaaagtgttgt
gtagaaactggtaagattattcgtgctgctgctgttgccgctggtgctccagcagacgca
gttcaatggattgaagaaccaagtttagatgctactactgatttaatgaataacccaggc
gttcaaactattttggctactggtggtccagggatggttaaggctgcttattcatcaggt
aagccagctattggtgttggtcctggtaacggtccatcttacattgaaaagtcagctaac
attgaccgtgctgtttatgacattgttttgtcaaagaacttcgataatggtatggtttgt
gcttctgaaaattcagttgttgtagacgacgaaatttacgacaaggttgttgatgaattc
aagaagtgggactgctacttcttaaacaaagaagaaattaagaagttcgaagaacacttc
atcgacccaagacgtggtactgttgcaggtcctgtagctggtaagtcagcttacgaaatt
gctaagctttgtggtgttgatgtaccaaaaaacaccaaggtaatcgttgctgaatacaac
ggtgttggtagaaagttcccactttcagctgaaaagctttcaccagtattcactttgtac
cgtgctaagaaccatgacgatgccttcagaatttgttctgaacttcttgattacggtggt
cgtggtcacaccgctggtcttcactcaagcgacaagaagatcattgatgaatttgcaatg
aagatggatgcttgccgtatcttggttaactcaccagctgccctcggtggtatcggtgac
ctttacaacaacatgttgccatcacttactttaggtactggttcttacggtgccaacacc
ttctcacacaacattggtgctaaggacttgcttaacatcaaaacagttgctatgcgtcgc
gacaacatgcaatgggtaaaggttccttctaagacctacttcgaacacaacgcagctaac
tacttacgtcacatgccaaacgtaaatcgtttcttcatcgttactgatgaaggtgttgct
gatgaaggctttgctgatgaaattactgacatcatttcaaagcgccgtggccaaaaggaa
tacgaagtatttaaggctgtaactcttgatcctaacactgacgtaattaaagacggtgtt
cacagaatgaacatcttcaagccagacgttgtgattgctatcggtggtggttcagtaatg
gacgctgctaaggcaatgcgtttgttctacgaaaacccagaaatgagttttgaggaagct
taccaaaagtttttggacatcagaaaaagagtagttcgcttcccaaagattaacggcgtt
caacttgtatgtatcccaactacttcaggtactggttcagaagtttcaccaattgctatc
attagcgatgctaagactggtattaagcacactttatgtgattatgctttaactccagat
gtttcaattgttgacgatcaatttgttcaagaaatgcctaagcgtttaattgcttggtca
ggttttgaagcattgggtcacgcaattgaaagttatgtttcaaccatggctactgacttt
actcgtggttggtcacttgaagctattaaaatcatttttgccaacttaaagaactcttac
gatggcaatcttgctgctcgtaagcaaatgcacgatgccgctactattgcaggtatggct
tactcaaacgcattccttgggttggaacactcaattgctcacactgtaggttcaaccttt
gatattccaagtggtgtaagtgatgctattgctttaccacaagttatccgcttcaattct
aagcgtccagaaaagcttgctatgtggcctcattactctgtttaccgtgctgatacagat
tatgcagatattgctaaggccattggcttgactggttcaagcaaggaagaattgattgaa
ggattagttcaaaagattatcgatttggctcaatcagttggtattaagatggcttataag
gactatggcgttgacaaggctgaattcgacaagaaagttgacgaattagctgttgaagca
tacggtgatcaaaacactgtaactaatccatcagctccacttattagtgaaattgctcaa
ttgatgagagacagctatgagggtaaaaatacttcaatcaataagtaa

DBGET integrated database retrieval system