KEGG   Lactobacillus amylovorus GRL1118: LAB52_02945Help
Entry
LAB52_02945       CDS       T01954                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lay00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LAB52_02945
Enzymes [BR:lay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LAB52_02945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
577747..578673
Genome map
AA seq 308 aa AA seqDB search
MKKIVVIGSSNVDTTLHVKDFPKPGETINATDVTTAGGGKGANQAIAAAKSGAETYFINR
VGEDSDGGYITHQLKSYGVDTTYVQTTIGAKTGHAYITLNEAGQNDIIIDHGANYELTVE
DLKAASDLINNWDCIIAQFETPIDVTTSAFKMAKKAGKVTILNPAPAIDKIPADLLKYTD
IIMPNETESAKITGIPIKDNSTLATNAEKLHLLGVKNVIITYGDKGAYISTPDVETLVPA
YKVDATDTTGAGDTFIGYFASNLNADMSNFEEAAKIASRASSIAVQRLGAQPSIPTEQEV
KQAMEDEE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagattgtagttattggatcaagcaatgttgataccacattgcacgtaaaggat
ttcccaaaacctggtgaaacgattaatgccacagatgttactactgctggtggtggtaag
ggtgctaaccaagccattgctgcagctaagagtggcgcagagacttactttattaaccgt
gtaggtgaagacagcgatggtggctacattacccaccaattgaagagctacggtgtcgac
accacttatgttcaaaccacgattggtgccaagactggccatgcttacattactttaaat
gaagctggtcaaaacgatattattatcgaccacggtgccaactatgaattgaccgttgaa
gatcttaaggccgctagcgatttgattaataattgggactgcattattgctcaatttgaa
acgccaattgatgttactacttcagctttcaagatggctaaaaaggcaggcaaggttact
attttgaatcctgctcctgcaattgataagattccagcagacttattgaaatatactgat
atcatcatgcccaatgaaactgaaagtgctaagatcacaggtattccaattaaagataat
tctactttggctactaacgctgaaaaattgcacttgcttggcgtaaagaacgtcattatt
acttatggtgataaaggtgcatatatttctacaccagatgttgaaacattagtaccggct
tacaaggtagatgctaccgatactactggtgccggtgacacctttatcggttactttgca
agtaacttgaatgccgatatgtctaactttgaagaagctgctaagattgctagccgtgct
tcatcaattgctgtgcaacgtttgggtgcacaaccatcaattcctactgaacaagaagta
aagcaagcaatggaggatgaggaataa

DBGET integrated database retrieval system