KEGG   Lactobacillus amylovorus GRL1118: LAB52_03090Help
Entry
LAB52_03090       CDS       T01954                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
lay00040  Pentose and glucuronate interconversions
lay00052  Galactose metabolism
lay00500  Starch and sucrose metabolism
lay00520  Amino sugar and nucleotide sugar metabolism
lay01100  Metabolic pathways
lay01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lay00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LAB52_03090
   00052 Galactose metabolism
    LAB52_03090
   00500 Starch and sucrose metabolism
    LAB52_03090
   00520 Amino sugar and nucleotide sugar metabolism
    LAB52_03090
Enzymes [BR:lay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LAB52_03090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AEA31592
UniProt: F2LYB7
Position
606403..607302
Genome map
AA seq 299 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKALPKEMLPIVDKPTIQFIVEEAKKSGIEDILIVIGKNK
RPIEDHFDSNPELEQDLAEKGKNELLKLTQGITNLGVNLYYTRQPHPAGLGDAIYRARSF
VGDEPFVVMLGDDLMDDETPLTKQLIDRYNKTHASTIAVMPVPHKEVSKYGVIEPENEIM
PGLINVKSFVEKPDIDKAPSDYAIIGRYLLTPEIFGILAHQKPGRGGEIQLTDAIDTMNK
TQRVFAHVFKGERHDVGNKEGYLETSIEYGLKHPEIKEQLRAYIQRLGKQFEAEDKAKK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaaaagctgttattcctgcagccggcttaggtactcgattcttacctgct
actaaggctttacctaaggaaatgctgccaatcgttgataaaccaactattcaatttatc
gttgaagaagctaagaagtctggtatcgaagatattttgatcgttatcggcaaaaacaag
cgcccaattgaagatcactttgattctaacccagaacttgaacaagacttagctgaaaag
ggcaagaacgaacttttgaaattaactcaaggcattactaatcttggcgttaatttatac
tacactagacaaccacatccagctggcttaggtgacgctatttaccgtgctcgcagtttc
gtaggggatgaaccatttgtcgttatgttaggtgacgacttgatggacgatgaaacgcca
cttactaagcaattgattgatcgctacaacaagactcatgcatcaaccattgccgttatg
ccagtaccacataaggaggtttcaaaatacggtgtaattgaaccagaaaacgaaattatg
ccaggtttgatcaacgttaagtcattcgttgaaaagccagacattgataaggcacctagt
gattacgcaattattggtcgctacctccttacaccagaaatttttggtattttagctcat
caaaaacctggtcgtggcggcgaaattcaattgactgatgccattgatacgatgaacaag
acgcaaagagtttttgctcatgtatttaagggtgaacgtcacgatgttggtaacaaggaa
ggctaccttgaaacttcaattgaatatggtttgaagcaccctgaaattaaggaacaactt
cgtgcttatattcaacgcttaggcaagcaatttgaagctgaagataaagccaaaaagtaa

DBGET integrated database retrieval system