KEGG   Lactobacillus amylovorus GRL1118: LAB52_03455Help
Entry
LAB52_03455       CDS       T01954                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lay00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LAB52_03455 (tpiA)
   01230 Biosynthesis of amino acids
    LAB52_03455 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAB52_03455 (tpiA)
   00051 Fructose and mannose metabolism
    LAB52_03455 (tpiA)
   00562 Inositol phosphate metabolism
    LAB52_03455 (tpiA)
Enzymes [BR:lay01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LAB52_03455 (tpiA)
Exosome [BR:lay04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LAB52_03455 (tpiA)
  Exosomal proteins of bladder cancer cells
   LAB52_03455 (tpiA)
  Exosomal proteins of melanoma cells
   LAB52_03455 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
691560..692318
Genome map
AA seq 252 aa AA seqDB search
MSRTPIIAGNWKLHMNPEQTTEFVDAVKDKLPDPSKVESLICAPAVDLDALRKAAKGSNL
HIGAENCYFEDEGAYTGETSPKVLKEMGMDYVIIGHSERRGYFHETDEDINKKAKAIFAN
GLKPIICCGESLETREANKQEDWVVAQIKAALDGLTAEQVSSLVIAYEPIWAIGTGKTAS
SDQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANVKELMSKPDIDGGLVGGASLK
PESYLELVNYQD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtacaccaattattgctggtaactggaaattacacatgaacccagaacaaact
actgagttcgttgacgcagttaaggacaagttaccagatccaagtaaggtagaatcactt
atttgtgcacctgcagttgaccttgatgctttgagaaaagctgctaagggttcaaacttg
cacatcggtgcagaaaactgctactttgaagacgaaggtgcttacactggtgaaacttca
cctaaggtcctcaaagaaatgggtatggactacgtaattattggtcactcagaacgtcgt
ggctacttccacgaaactgatgaagacattaacaagaaggccaaggcaatctttgctaat
ggcttgaagccaattatttgctgtggtgaatcacttgaaactcgtgaagctaacaagcaa
gaagactgggtagttgctcaaattaaggctgctttagatggtcttactgctgaacaagta
tcttcacttgtaattgcttatgaaccaatctgggctattggtactggcaagactgcttca
tcagaccaagctgaagaaatgtgcaagactattcgtgaaactgtaaaggacttgtacaac
gaagaaactgcagaaaacgttcgtattcaatacggtggttctgtaaagccagctaacgtt
aaggaattaatgtcaaagcctgacattgacggtggcttagttggtggtgcttcacttaag
cctgaatcatacttagaattggtaaactaccaagactaa

DBGET integrated database retrieval system