KEGG   Lactobacillus amylovorus GRL1118: LAB52_03600Help
Entry
LAB52_03600       CDS       T01954                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lay00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
713247..714722
Genome map
AA seq 491 aa AA seqDB search
MSFPKNFLWGGATAANQIEGAYDEDGKGLSVTDITTAGSLDHPRMLTYKLNGKLGKIPGL
PGAGLPEGAVGAIDPNEYYPNHVAIDFYHHYKEDIKMFAEMGFKTFRLSIAWTRIFPKGD
EEKPNQAGLDFYRRVFEECKKYDIEPLVTISHYEDPLYLSEKYHDWQDRKMIDMYVKYAK
VLFKEYKGLVKYWLTFNEINTAVMMLDMFGNKNDSDEAYQHAYQKLHYQFVASARAVKAA
HEIDPNYVVGNMICGIVDYPLTPDPQDVLKCRHDWEKNIFYCGDVQCKGKYPTFAKRLWD
EHNVHLDITDQDRKDLAEGKVDMYTFSYYMSNVVTTHEVKDKVGGNFAAGAKNPYLKYSE
WGWATDPTGLQYYLEVIYDRYEIPVMVVENGLGAVDKVTADGKIHDDYRIDYLRQHIEAM
QKAIDDGVDLIGYTTWGCIDLVSAGTGQMSKRYGFIYVDRDDNGNGSLKRIPKDSFYWYK
KVIESHGEDLD
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttccaaagaactttttatggggcggtgcaactgctgctaaccaaatcgaaggt
gcctacgatgaagacggtaagggcttatctgtaacagacattacgactgccggtagttta
gatcatcctagaatgttgacttataagttaaatggtaaacttggcaagatcccaggcctt
cctggtgctggtctaccagaaggtgctgttggtgctattgatcctaacgaatattaccct
aaccacgtagcgattgatttttaccaccactacaaagaagacattaagatgttcgctgaa
atgggctttaagacattccgtctttcgattgcctggacaagaatctttccaaagggtgat
gaagaaaagccaaatcaagcagggttagacttttaccgccgcgtctttgaagaatgcaag
aaatacgatattgaacctttagttactatttctcactatgaagatccgctttatttgagt
gaaaagtatcatgactggcaagatcgtaagatgatcgacatgtatgtcaagtacgctaag
gttttgtttaaagaatacaagggcttagtcaaatactggctaacattcaatgaaattaat
actgcagtaatgatgctagacatgtttggcaacaagaacgattctgatgaagcctaccaa
catgcatatcaaaaattgcactaccaatttgttgcgagtgctcgtgcagttaaggcagcc
catgaaatcgatccaaactatgtagtaggtaatatgatctgtggtatcgttgattaccca
ttgactccagatcctcaagatgtcttgaagtgccgtcatgattgggaaaagaacatcttc
tactgtggtgatgttcaatgtaaaggtaaatatccaacttttgctaaacgtctttgggat
gaacataatgttcaccttgatattactgatcaagaccgtaaggacttggcggaaggtaaa
gttgatatgtacactttctcttactacatgtccaacgttgtaactactcatgaagtaaag
gacaaggtaggcggcaacttcgcagctggcgccaagaacccatacttgaaatattcagaa
tggggctgggcaactgacccaactggtttacaatactaccttgaagttatttacgatcgt
tacgaaattccagtaatggtagttgaaaatggtttgggtgctgttgataaagtgactgct
gatggcaagatccatgatgattaccggattgattacttgcgccaacacattgaagcaatg
caaaaggccattgatgatggcgttgatttgatcggctacaccacttggggctgtatcgat
ttggtttctgcaggtactggtcaaatgtctaagcgttatggctttatctatgtagaccgt
gacgataacggaaatggttcacttaagagaattcctaaggattcattctattggtacaag
aaggttatcgagtctcacggtgaagatttagactaa

DBGET integrated database retrieval system