KEGG   Lactobacillus amylovorus GRL1118: LAB52_03880Help
Entry
LAB52_03880       CDS       T01954                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lay00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:lay00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(762764..763906)
Genome map
AA seq 380 aa AA seqDB search
MKKKLLILTALATTALLITGCQHQIKANSRTTNFKTTAVKKKTNKIDLILKHMTLNEKIG
QLYFAHSTGNTKQMMQDVKKYHLGGTTLFAPDFQNKTKAQFDSEMRNYQKNSNHGLLIAT
DQEGGTVSRIDTNPSISQRKYPSPQEIYNTQGLTGIQKEDQTVAKILHQNGINMNFAPVA
DVAKDKNSFIYDRTLGQDYETTAKYIPVAVKSIQSQKVASCLKHFPGYGDAGDTHTGFAQ
INKPLSEYKKEDLLPFKAGIKAGVDEIMISHIVVKNIDTKMPASLSPAVHKLLRKNLAYQ
GLMITDDLQMGAITQYAKQHHINADVLALKAGNDMLLGGNYQTGILAIKKAVQKGTISQK
QINDSVRRILQLKEKLGILK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaactattaattttgactgctttagcgactacggcattattaattaccggt
tgccagcatcagataaaagctaacagtagaacaactaattttaaaactacggctgttaaa
aagaaaaccaataaaatcgatttgatccttaagcacatgactttaaacgaaaaaatagga
caattgtattttgctcatagtacaggcaacaccaagcaaatgatgcaagatgttaaaaaa
tatcacttgggcggtactactctatttgcaccggattttcaaaataagactaaggctcaa
tttgattcggaaatgcgcaattatcaaaaaaacagcaatcatggtttactaattgccacc
gaccaagaaggtggaacagtttcccgaattgataccaatcctagtatttcacaacgaaaa
tatcctagtccccaagaaatttataatactcaaggtctaactggcatccaaaaagaagat
caaacagtagctaaaattctgcatcaaaatggtataaacatgaattttgcccctgttgct
gatgttgccaaagataagaatagttttatttatgatcgaaccttaggacaagattatgaa
acaacagctaagtatattccagttgctgtcaaaagcatccaaagtcaaaaagttgctagt
tgtcttaaacactttccaggatacggagatgccggtgatactcataccggttttgcccaa
atcaataagccattgtctgaatataaaaaggaagatcttttaccttttaaggctggaatt
aaagctggcgtggatgaaatcatgatttcacacatcgtggtcaaaaatattgatactaaa
atgccggcatccctctccccagccgtgcacaaattactccgtaagaatttagcttatcaa
ggtctaatgattactgacgacttacaaatgggagcaatcactcagtacgctaagcagcac
cacattaatgccgacgttctggctctaaaagctggcaatgatatgcttttaggtgggaat
tatcaaaccggcatccttgctattaagaaagccgtacaaaaaggtacaatcagccaaaag
caaattaatgattcagttagaagaattttgcagttaaaagaaaagttaggcattcttaaa
taa

DBGET integrated database retrieval system