KEGG   Lactobacillus amylovorus GRL1118: LAB52_03880Help
Entry
LAB52_03880       CDS       T01954                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lay00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LAB52_03880
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    LAB52_03880
Enzymes [BR:lay01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LAB52_03880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(762764..763906)
Genome map
AA seq 380 aa AA seqDB search
MKKKLLILTALATTALLITGCQHQIKANSRTTNFKTTAVKKKTNKIDLILKHMTLNEKIG
QLYFAHSTGNTKQMMQDVKKYHLGGTTLFAPDFQNKTKAQFDSEMRNYQKNSNHGLLIAT
DQEGGTVSRIDTNPSISQRKYPSPQEIYNTQGLTGIQKEDQTVAKILHQNGINMNFAPVA
DVAKDKNSFIYDRTLGQDYETTAKYIPVAVKSIQSQKVASCLKHFPGYGDAGDTHTGFAQ
INKPLSEYKKEDLLPFKAGIKAGVDEIMISHIVVKNIDTKMPASLSPAVHKLLRKNLAYQ
GLMITDDLQMGAITQYAKQHHINADVLALKAGNDMLLGGNYQTGILAIKKAVQKGTISQK
QINDSVRRILQLKEKLGILK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaactattaattttgactgctttagcgactacggcattattaattaccggt
tgccagcatcagataaaagctaacagtagaacaactaattttaaaactacggctgttaaa
aagaaaaccaataaaatcgatttgatccttaagcacatgactttaaacgaaaaaatagga
caattgtattttgctcatagtacaggcaacaccaagcaaatgatgcaagatgttaaaaaa
tatcacttgggcggtactactctatttgcaccggattttcaaaataagactaaggctcaa
tttgattcggaaatgcgcaattatcaaaaaaacagcaatcatggtttactaattgccacc
gaccaagaaggtggaacagtttcccgaattgataccaatcctagtatttcacaacgaaaa
tatcctagtccccaagaaatttataatactcaaggtctaactggcatccaaaaagaagat
caaacagtagctaaaattctgcatcaaaatggtataaacatgaattttgcccctgttgct
gatgttgccaaagataagaatagttttatttatgatcgaaccttaggacaagattatgaa
acaacagctaagtatattccagttgctgtcaaaagcatccaaagtcaaaaagttgctagt
tgtcttaaacactttccaggatacggagatgccggtgatactcataccggttttgcccaa
atcaataagccattgtctgaatataaaaaggaagatcttttaccttttaaggctggaatt
aaagctggcgtggatgaaatcatgatttcacacatcgtggtcaaaaatattgatactaaa
atgccggcatccctctccccagccgtgcacaaattactccgtaagaatttagcttatcaa
ggtctaatgattactgacgacttacaaatgggagcaatcactcagtacgctaagcagcac
cacattaatgccgacgttctggctctaaaagctggcaatgatatgcttttaggtgggaat
tatcaaaccggcatccttgctattaagaaagccgtacaaaaaggtacaatcagccaaaag
caaattaatgattcagttagaagaattttgcagttaaaagaaaagttaggcattcttaaa
taa

DBGET integrated database retrieval system