KEGG   Lactobacillus amylovorus GRL1118: LAB52_04120Help
Entry
LAB52_04120       CDS       T01954                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lay00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LAB52_04120
Enzymes [BR:lay01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LAB52_04120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
807868..810219
Genome map
AA seq 783 aa AA seqDB search
MVEFTGKVNGIVFENDKDLYKILDVEIIGSLENYSRDEIKVTGNFGDIQISASYRFEGKL
VMHEKFGLQFRATSYKQVLPHEEGSLTKYLSSDKFPGIGKKAANTIIDELGLNALDILKE
KPAKIDTLSLTRKQKDSLLSGLNSMDSYSEIVLKLAQYGINRRIAANIYQLYHGDSLKKL
QTDPYAVINDVSGFGFKSADMLGKQLEIKDDDPRRINGAIYQVLIDALSGSGDTYVPLKE
LLTEASKLLQIDKFDPIANCVLGLQQDGKIVVNDDVAALQNIYQTEVDIAHSMKYLVESR
QDQEDEQYSEKEMNTAIKDAEKELKIKYDETQKLAIKNALNHPISILTGGPGTGKTTIIN
GILLALRKLAEIPASALYSEDPPFLLAAPTGRAAKRMSEITGIGAKTIHRMLGLGIGDAG
TGELNELNGEILIIDEMSMVDMFLFKQLLSSINQIRHIVFVGDKDQLPSVGAGNVFSDLI
KSQAFPTTILKEIHRQGDDSTIISLAHAVNEGVNEGALFKKTKNYSFISCRPDLVGDAVG
QIVELALKRGFAKDDIQVLGAMYHGNGGVDNLNDIIQEIMNPPKAKSKSLEAHNETFRIG
DRILQLQNNPEKDIYNGQIGKISSIDEENSEECMVAKFDDREVTFGRKDLNDLTRAYAIT
IHKSQGSEFPLVVLNLTMQNYVMLKRNLLYTAITRAEKNLVLVGDPRAFEAAFKTSGNDR
KTGLASKLRKQLGITVKPENVQEPESKPKEKTKPKQPEDYILTPEKIYSGEIDPMIGMED
IHL
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaatttaccggtaaggttaacggaatcgttttcgagaacgacaaggatttatat
aaaattttagatgttgaaattattggctcactagaaaactattcacgcgatgaaataaaa
gtgaccggtaattttggcgatattcaaatttcagctagttatcgttttgaaggcaaactt
gtgatgcatgaaaagtttggtttgcaatttagagctactagctataagcaggttttgccg
catgaagaaggttcattaactaaatatttgagttctgataaattcccaggcataggaaaa
aaggctgccaatacgattatcgatgagctaggcttaaatgctttggatattttaaaagaa
aagcctgctaagattgatactttatctttaactagaaaacaaaaagatagcttgctttct
gggctgaattcaatggattcttattcagaaattgtcttgaaattagcacagtacgggatc
aatcgtcgaattgcagctaatatttatcagttatatcatggcgacagtctaaagaaactg
caaacagatccttatgcagtgatcaatgatgtaagtggttttggttttaaatcagccgat
atgttgggtaaacagttagaaattaaggatgatgatccccgcagaatcaacggtgcgatt
tatcaggtgttgattgacgctttaagtggtagcggcgatacttatgtaccgcttaaggaa
cttctgacagaagcaagcaaactattgcaaattgataaatttgatcctattgctaattgt
gtccttggtttgcaacaagatggcaagatcgtagtcaatgatgatgtagcggctttacaa
aacatctaccaaacggaagttgatattgctcactcgatgaaatatttggttgaatccaga
caggatcaagaagatgaacaatatagcgagaaagagatgaacacagccattaaggatgca
gaaaaagaactgaaaattaaatatgacgaaacgcaaaaattagctatcaaaaatgcgttg
aatcatcctatttcaattttgactggtggccctggtacaggtaaaactacgattatcaac
ggaattttactagctttgagaaagctggctgaaatcccagcttctgctttgtacagtgaa
gatccaccattccttttggctgcacctactggccgtgcggctaagagaatgagtgagatt
actggtatcggtgctaaaacgattcacagaatgctgggattaggtattggggatgcaggc
actggtgaactaaatgaattaaacggtgaaatattaattattgacgagatgtcgatggtt
gatatgttcttgtttaaacagcttttgtccagtattaatcaaattcgccatattgtcttt
gtcggtgataaggatcagcttccatcagttggtgcgggtaatgttttcagtgatttgatt
aagtcgcaagcatttccaacaacgattttgaaagaaatccatcgacaaggtgacgattca
acgattatttcgcttgcccatgcggtcaatgaaggtgtgaatgaaggtgctttatttaag
aagacaaagaactattcatttatcagctgtcgaccagatttggtgggggatgcagttggt
caaattgttgaacttgctttaaagcgtggttttgctaaagatgatattcaagttttaggt
gcaatgtatcatggcaatggcggagtagataacttaaacgatattattcaagaaatcatg
aatccgcctaaggctaaaagtaagtcactggaagctcataacgaaactttccggattggc
gacagaattttgcaattgcagaataatcctgaaaaggacatttataatggccaaatcggt
aaaattagcagtatcgatgaagagaactccgaagaatgcatggttgccaagtttgatgat
cgtgaagttacttttgggcgaaaagatttaaatgatttaactagggcctatgcgattaca
attcataaatctcaaggttcagaatttccattagtagttctcaacctaacgatgcagaac
tatgtgatgctgaaacgaaatcttttgtatactgcaattacccgtgctgaaaagaatttg
gtgttagtaggagatcctagagcttttgaagcggcctttaaaacatcaggcaatgaccgt
aaaactggtctagcttccaaattacgtaaacaattaggcattacggttaaaccggaaaat
gttcaggaaccagagtcaaagccaaaagaaaaaacaaaacctaagcaaccggaggattat
attctaactcctgaaaaaatttattcaggtgaaattgatccaatgatcggtatggaagat
attcatttataa

DBGET integrated database retrieval system