KEGG   Lactobacillus amylovorus GRL1118: LAB52_04480Help
Entry
LAB52_04480       CDS       T01954                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lay00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LAB52_04480
   00670 One carbon pool by folate
    LAB52_04480
Enzymes [BR:lay01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LAB52_04480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
879364..879870
Genome map
AA seq 168 aa AA seqDB search
MIEYVWAEDKKRQIGVDGHLPWHLPADLKHFKEKTMDHPILMGRKTFASLPKLLPGRKHI
VLTHNEEMKSKWKDNNQVEILTSIDEMNEYLSNHQSEKICAIGGVSIFKALLDQVDILEK
TEIEGAFKADTVMPEIDYSQFDLVHQEHHDADSKNKYPYTFLTYIRKH
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaatatgtttgggcagaagataaaaaaagacaaattggcgtagatgggcacttg
ccttggcatttaccagctgacttaaagcattttaaagaaaagacaatggatcatccaatt
ttaatgggtaggaaaacttttgctagcttacccaagttattgccaggacgaaagcacatt
gttttgacccacaatgaagaaatgaaaagtaaatggaaagataataaccaggtagagatt
ttgacatcaatcgatgaaatgaatgaatatctttccaatcatcaaagtgaaaagatatgt
gcgattggtggcgtatcaatttttaaagccttgcttgatcaggttgatatccttgaaaaa
actgaaattgagggcgcctttaaagcagatacagttatgccagagattgattactcacag
tttgatttagtgcatcaagagcatcacgatgccgatagcaagaataaatatccttatact
tttttgacttatataagaaaacactaa

DBGET integrated database retrieval system