KEGG   Lactobacillus amylovorus GRL1118: LAB52_04775Help
Entry
LAB52_04775       CDS       T01954                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:lay00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LAB52_04775
   01230 Biosynthesis of amino acids
    LAB52_04775
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAB52_04775
   00030 Pentose phosphate pathway
    LAB52_04775
   00051 Fructose and mannose metabolism
    LAB52_04775
   00052 Galactose metabolism
    LAB52_04775
  Energy metabolism
   00680 Methane metabolism
    LAB52_04775
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LAB52_04775
Enzymes [BR:lay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LAB52_04775
Protein phosphatases and associated proteins [BR:lay01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LAB52_04775
Messenger RNA biogenesis [BR:lay03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LAB52_04775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
941359..942321
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAVTKTAIHHGLEVFGIRYGFAGLVAGDFVPLTTENVDHK
INEGGTFLYSARFPEFAQEEVQQKGVEQLKKHGIDAVIVIGGDGSYHGALALTRHGVNSV
GLPGTIDNDIPYTDYTIGFDSACRTAMDAIDKIRDTASSHHRVFIVNVMGRECGDIAMRV
GVASGADAIVIPERPYDIKEIAETLKRGFADGKDHGIIVLAEGVMAADKFKDELLKYGDF
DARANVLAHMQRGGSPTVTDRVNATKMGNYAVKLLLDGKGGLAVGIENSKLETHDILDLF
DGKHQGDYALMDVNEEMTKY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtattttaactagtggtggagacgcccctggtatgaatgcagcaatt
agagctgtgacaaagactgccattcatcatggccttgaagtctttggaattcgttacggt
ttcgctggtttggttgcaggtgactttgttccgctaactacggaaaatgttgaccacaag
attaatgaaggcggtacattcttgtacagtgctcgtttccctgaatttgcacaagaagaa
gtgcaacaaaagggtgtagagcaattgaagaagcacggtatcgatgcagttatcgttatt
ggcggtgatggatcataccacggtgctttggccttaactcgccacggcgtaaactcagtt
ggtttgccaggaactatcgacaacgatattccttacactgactacacgatcggctttgat
tctgcttgtcgtactgctatggacgcaattgataagattcgtgacactgcaagtagtcac
cacagagtattcattgttaacgtaatgggtcgtgaatgtggtgatattgctatgcgtgtt
ggtgttgcaagcggcgcagatgctattgtaattcctgaacgtccttatgacattaaggaa
attgcagaaactcttaaacgcggatttgcagatggcaaagatcatggtatcattgtctta
gcagaaggtgtcatggctgccgataaatttaaggatgaattacttaaatacggtgacttt
gatgcccgtgctaatgtccttgcacatatgcaacgtggtggctcacctactgtcacagat
agagtaaatgctactaagatgggtaactatgctgttaagttgcttcttgatgggaagggc
ggtttagctgtcggcatcgagaatagcaaacttgaaacccacgacattcttgatttgttt
gatggtaaacaccaaggcgactatgcgcttatggatgtaaatgaagaaatgactaaatat
taa

DBGET integrated database retrieval system