KEGG   Lactobacillus amylovorus GRL1118: LAB52_05535Help
Entry
LAB52_05535       CDS       T01954                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
lay00010  Glycolysis / Gluconeogenesis
lay00260  Glycine, serine and threonine metabolism
lay00680  Methane metabolism
lay01100  Metabolic pathways
lay01110  Biosynthesis of secondary metabolites
lay01120  Microbial metabolism in diverse environments
lay01130  Biosynthesis of antibiotics
lay01200  Carbon metabolism
lay01230  Biosynthesis of amino acids
Module
lay_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAB52_05535
  Energy metabolism
   00680 Methane metabolism
    LAB52_05535
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LAB52_05535
Enzymes [BR:lay01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LAB52_05535
Membrane trafficking [BR:lay04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LAB52_05535
Exosome [BR:lay04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LAB52_05535
  Exosomal proteins of melanoma cells
   LAB52_05535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEA32052
UniProt: F2LZP9
Position
1083452..1084099
Genome map
AA seq 215 aa AA seqDB search
MRLLVVRHGQSEADILKVCEGLANYSLTKFGHEQAERTAEYIFKNYKVDKIYSSSLKRAV
QTAMHISKKTNIKVIQEDKLQEFNNGLRAGLEYKLAYEKYPNISTAIHESHYQQESELEF
RMRAEYVLSKILSENEPASTIVIVSHGGMIMRLYQAFLKLPVGSNVKLITGDAGIHDWSI
EDGQQFINYSNFPHFYRIKLTPSNIAAEAEAAAKK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcgattattagtggtcagacatggtcaaagtgaagccgatatattgaaagtatgtgaa
ggtcttgcaaattattctttaacaaaatttggacatgaacaagcagaaagaacagcagag
tatattttcaagaactacaaagtagataagatttattcaagttctttaaaacgagcagtg
caaacagcaatgcacatatcgaagaaaactaatattaaagtcattcaagaagataaattg
caggaatttaataatggcttaagagcggggttagaatataaattagcttacgaaaaatat
cccaatatatcaactgcaatacatgaatcgcactatcagcaagaaagtgaacttgaattt
agaatgagggccgagtatgttctctcaaaaatccttagtgagaatgaacctgcttcaaca
atagtaatagttagtcatggtggaatgattatgcgattatatcaagcttttcttaaacta
ccagtaggatcaaatgttaagttgattaccggggatgctggaattcatgattggtcaatt
gaagatggacaacagtttataaactattctaattttccccatttttatcgaattaaatta
acgccatcaaatatagctgctgaagcagaagctgccgcaaagaagtaa

DBGET integrated database retrieval system