KEGG   Lactobacillus amylovorus GRL1118: LAB52_05535Help
Entry
LAB52_05535       CDS       T01954                                 

Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lay00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LAB52_05535
   01230 Biosynthesis of amino acids
    LAB52_05535
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAB52_05535
  Energy metabolism
   00680 Methane metabolism
    LAB52_05535
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LAB52_05535
Enzymes [BR:lay01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LAB52_05535
Exosome [BR:lay04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LAB52_05535
  Exosomal proteins of melanoma cells
   LAB52_05535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1083452..1084099
Genome map
AA seq 215 aa AA seqDB search
MRLLVVRHGQSEADILKVCEGLANYSLTKFGHEQAERTAEYIFKNYKVDKIYSSSLKRAV
QTAMHISKKTNIKVIQEDKLQEFNNGLRAGLEYKLAYEKYPNISTAIHESHYQQESELEF
RMRAEYVLSKILSENEPASTIVIVSHGGMIMRLYQAFLKLPVGSNVKLITGDAGIHDWSI
EDGQQFINYSNFPHFYRIKLTPSNIAAEAEAAAKK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcgattattagtggtcagacatggtcaaagtgaagccgatatattgaaagtatgtgaa
ggtcttgcaaattattctttaacaaaatttggacatgaacaagcagaaagaacagcagag
tatattttcaagaactacaaagtagataagatttattcaagttctttaaaacgagcagtg
caaacagcaatgcacatatcgaagaaaactaatattaaagtcattcaagaagataaattg
caggaatttaataatggcttaagagcggggttagaatataaattagcttacgaaaaatat
cccaatatatcaactgcaatacatgaatcgcactatcagcaagaaagtgaacttgaattt
agaatgagggccgagtatgttctctcaaaaatccttagtgagaatgaacctgcttcaaca
atagtaatagttagtcatggtggaatgattatgcgattatatcaagcttttcttaaacta
ccagtaggatcaaatgttaagttgattaccggggatgctggaattcatgattggtcaatt
gaagatggacaacagtttataaactattctaattttccccatttttatcgaattaaatta
acgccatcaaatatagctgctgaagcagaagctgccgcaaagaagtaa

DBGET integrated database retrieval system