KEGG   Lactobacillus amylovorus GRL1118: LAB52_06210Help
Entry
LAB52_06210       CDS       T01954                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lay01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lay00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:lay00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1211018..1212517
Genome map
AA seq 499 aa AA seqDB search
MKYRSTRGAKDNALTSPAAIIQGLAQDGGLYVPVDFPKANFQLEDLPKLSYKQISAMIIS
LFFDDFSKDQIKSAVINAYSEQWDDRSIVPIEKHNDNFYMELFHGPTLAFKDIALQMLPQ
LMTRAVQIEKIDRDIIILTATSGDTGTASMRGFANQKGTRVIVFYPEGGVSPVQLKQMLS
QHGDNLEAIAIKGNFDDVQTEVKKIFNDENFRKKLNQNGFQFSSANSMNIGRLVPQISYY
LYTYGQLVRRREINLGDKVNFTVPTGNFGDILAGYYAEKLGLPINKLICASNENNVLTDF
FAKGEYDKRRKFHLTNAPAMDILVSSNLERLLFDLYDKDNEKIASLMNQLTQRGHYQVDK
EVLDKLQTIFAAGFATEDEVKEEIHRVYNYDRYVIDPHTAVGSYVAQQYKSKTNDQTPMV
IVSTASPYKFPETVYEAITGRVCPQTGVAAIKKLHDELGGQLSIGVRTLFDHEPHVEKVI
DPVNMEAAISSILDLKQFI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatcgtagtactcgaggcgcaaaagacaatgcgttaacttcaccagccgcaatc
atccaagggttggcccaagatggtggactttatgtaccagtagattttccaaaagctaat
tttcaactagaagatttacctaagttatcttataagcaaatttcagcaatgatcattagc
ttattttttgatgatttttctaaggatcaaattaaatctgcagtaatcaatgcttatagc
gaacaatgggacgaccgcagcattgtgccaattgaaaaacacaacgataatttttacatg
gaactctttcacggtccaactttagcttttaaagatattgctttgcagatgttaccacag
ctaatgacacgtgcagtacaaattgagaaaatcgatcgtgacatcattatcttgactgct
acttctggtgacaccggaactgcttcaatgcgcggctttgctaaccaaaaaggtacacgc
gtcatcgtcttctatcctgaaggcggcgttagccctgtccaacttaaacaaatgctcagt
caacacggcgacaatttggaagccatcgcgatcaagggtaactttgacgatgtgcaaact
gaagtaaagaagatttttaacgatgaaaacttcagaaagaaactaaaccaaaacggtttc
caattctcatctgctaactcaatgaacattggtcgtcttgttcctcaaatttcttattac
ctttacacttatggtcaattggttcgccgtcgtgaaatcaacttgggcgacaaagtaaac
tttaccgtacctacaggcaatttcggcgacattttagctggttactatgcagaaaaactc
ggtttgccaatcaacaaattgatctgtgcttcaaatgaaaacaacgttcttactgacttt
tttgccaaaggtgaatacgacaagcgtcgtaagttccatttaactaacgcaccagcaatg
gatattttagtttcaagcaatctagaacgacttttattcgatttatatgataaagataat
gaaaaaattgctagtctaatgaatcaattaacgcaaagaggtcattaccaagtcgacaaa
gaggtcttagacaaattacaaactatttttgcggctggttttgccactgaagatgaagta
aaagaagaaattcaccgcgtctacaattatgatcgctacgtaattgatcctcatactgca
gtaggttcatacgttgctcagcaatataagagcaagacaaacgatcaaacaccaatggtg
attgtgtctactgctagtccttataagttccctgaaaccgtttatgaggctattacaggt
agagtttgtcctcaaactggcgtagctgctattaagaagttgcatgatgaattgggtggt
caattatccatcggtgtacgcaccttgtttgaccacgaaccacacgttgaaaaagtaatt
gatccagtcaacatggaagcagctatcagttcaattttagatttaaagcaattcatttag

DBGET integrated database retrieval system