KEGG   Lactobacillus amylovorus GRL1118: LAB52_06820Help
Entry
LAB52_06820       CDS       T01954                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
lay00230  Purine metabolism
lay01100  Metabolic pathways
Module
lay_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lay00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LAB52_06820 (gmk)
Enzymes [BR:lay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LAB52_06820 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA RsgA_GTPase MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AEA32289
UniProt: F2M0T5
Position
complement(1338186..1338800)
Genome map
AA seq 204 aa AA seqDB search
MADKGLLLVLSGPSGVGKGTVKSAIVENKVFPFEYSVSMTTRKPRPGEVDGKDYFFVSEE
RFQEAIKNGELLEYNEYVGHHYGTPLAPVKKMLHEGKDVLLEIDVNGAQKVREKMPDGVF
IFLTPPDLHTLHLRLEHRGTEPEEVIRGRIKQARNEILEMEDYDYAVVNDTVANAVDHIK
AIVDAEHVSVKRVIDDYRKMVKED
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcagataaaggtttattacttgtactttccggtccctcaggtgttggtaaagggact
gtaaaaagtgctattgtggagaacaaggtctttccatttgaatattcagtctcaatgact
actagaaaacctcgtccaggtgaagttgacggcaaggattacttctttgtcagcgaggaa
cgttttcaagaagctattaaaaatggggagctattagaatataatgaatacgttggacat
cattatggaacgcccctcgctccagtgaagaagatgcttcatgaaggcaaggatgtttta
cttgaaattgatgtcaatggggcacaaaaagtgcgtgaaaagatgccagatggcgtattc
atctttttaaccccacctgatttacatactttgcatttgcgattagaacatcgtggtaca
gaaccagaagaagtaattcgtggtcgtatcaagcaagccagaaatgaaattctagaaatg
gaagactatgattatgcagtagttaatgatacagtagctaatgcagtagatcatattaaa
gcaattgttgatgcagaacatgtcagtgttaaacgtgtaattgatgactaccgcaagatg
gtcaaggaggattaa

DBGET integrated database retrieval system