KEGG   Lactobacillus amylovorus GRL1118: LAB52_06820Help
Entry
LAB52_06820       CDS       T01954                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lay00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1338186..1338800)
Genome map
AA seq 204 aa AA seqDB search
MADKGLLLVLSGPSGVGKGTVKSAIVENKVFPFEYSVSMTTRKPRPGEVDGKDYFFVSEE
RFQEAIKNGELLEYNEYVGHHYGTPLAPVKKMLHEGKDVLLEIDVNGAQKVREKMPDGVF
IFLTPPDLHTLHLRLEHRGTEPEEVIRGRIKQARNEILEMEDYDYAVVNDTVANAVDHIK
AIVDAEHVSVKRVIDDYRKMVKED
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcagataaaggtttattacttgtactttccggtccctcaggtgttggtaaagggact
gtaaaaagtgctattgtggagaacaaggtctttccatttgaatattcagtctcaatgact
actagaaaacctcgtccaggtgaagttgacggcaaggattacttctttgtcagcgaggaa
cgttttcaagaagctattaaaaatggggagctattagaatataatgaatacgttggacat
cattatggaacgcccctcgctccagtgaagaagatgcttcatgaaggcaaggatgtttta
cttgaaattgatgtcaatggggcacaaaaagtgcgtgaaaagatgccagatggcgtattc
atctttttaaccccacctgatttacatactttgcatttgcgattagaacatcgtggtaca
gaaccagaagaagtaattcgtggtcgtatcaagcaagccagaaatgaaattctagaaatg
gaagactatgattatgcagtagttaatgatacagtagctaatgcagtagatcatattaaa
gcaattgttgatgcagaacatgtcagtgttaaacgtgtaattgatgactaccgcaagatg
gtcaaggaggattaa

DBGET integrated database retrieval system