KEGG   Lactobacillus amylovorus GRL1118: LAB52_07410Help
Entry
LAB52_07410       CDS       T01954                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lay00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LAB52_07410
Enzymes [BR:lay01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LAB52_07410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1439887..1441329)
Genome map
AA seq 480 aa AA seqDB search
MPIKNKVMLITYPDSLGKNLQELSEVLENDLKGAVGGIHLLPFFPSTGDRGFAPTDYTTV
DPKFGNWSDVEKLGEKYYLMFDFMINHISRHSKYYEDFQKNKDKSSYADMFLSWDKFWPK
GRPTKEDVDLIYKRKDRAPYQEITFADGSKEKLWNTFGPEQIDLDVRKKVTQKFIKDTLV
SLIKHGADIIRLDAFAYAVKKLDTNDFFVEPEIWNLLKQVQDDIADEGATILPEIHEHYS
MPFKISKHGYFIYDFALPMVTLYSLYSGKSNRLAAWLKKCPMKQFTTLDTHDGIGVVDAR
DILSPEEIDYTSQELYKVGANVKKKYSSAEYHNLDIYQINTTFYSALGDDDKRYFMARLL
QVFAPGIPQVYYVGMLAGKNDIKLLEETKEGRNINRHYYSKAEVEQEIQRPVVASLLKLF
TFRNNEPAFDLNGSIDISTPNENEIRIVRINKEQNHKAELTANLQDLTYRVLVNGKQINF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccaattaaaaataaagtaatgttgattacctatccagatagtttaggtaaaaacttg
caagaattaagcgaagtcttagaaaatgatttaaaaggtgcggttggcggcattcattta
ctgccattctttccttcaacgggtgatcgcggatttgcaccaactgattacacgacagtt
gatcctaaatttggtaattggtcagatgttgaaaagttgggcgaaaaatactacctgatg
tttgattttatgatcaatcatatttctaggcattctaagtattacgaagattttcaaaag
aataaggacaaaagttcatatgcagatatgttcttaagttgggataagttttggccaaaa
ggtcgtccaactaaagaagatgtggacctaatctataagcgtaaagatcgtgctccatat
caagagattacttttgcggatgggagcaaggagaaactttggaatacttttggtcctgag
caaatcgatttagatgtgcgcaaaaaggttacgcaaaagtttattaaggacacgttggtt
agcctaattaagcacggagcagatatcattcgtttggatgcttttgcttatgctgtgaaa
aaactagatactaatgacttctttgtagaaccagaaatctggaatttgcttaagcaggta
caagatgatattgctgatgaaggagcaacgattttgccagaaatccatgagcattattct
atgccgttcaagatttcaaaacatggctactttatctacgactttgctctaccaatggtt
actctgtattcgctttattcaggtaaatccaatcgtttggcagcttggctaaagaaatgt
ccaatgaagcaattcactaccttggatactcatgatggtattggcgtagttgatgcgcgt
gatattctttctccagaagagatcgattacaccagccaagaactttataaagttggtgct
aatgttaagaaaaagtattcaagtgctgaatatcataatttggatatttatcaaattaat
actactttttattcagctttgggcgatgacgataaaagatacttcatggcaagattattg
caggtctttgctcctgggattccgcaggtctactatgttgggatgttagctggcaagaat
gatattaagctccttgaagaaactaaagaggggagaaatattaatcgtcattattacagc
aaagctgaagttgaacaagaaattcagcgacctgttgttgcctctttgttgaaactcttt
acttttagaaacaatgaacctgcatttgacttaaatggttctattgatatctctacccct
aatgaaaatgaaatccgtattgttcgaatcaataaagaacaaaatcataaagcagaatta
actgctaacttacaagatttaacttaccgagttttggttaacggtaagcaaatcaacttt
taa

DBGET integrated database retrieval system