KEGG   Lactobacillus amylovorus GRL1118: LAB52_08510Help
Entry
LAB52_08510       CDS       T01954                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lay00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LAB52_08510
   00052 Galactose metabolism
    LAB52_08510
   00500 Starch and sucrose metabolism
    LAB52_08510
   00520 Amino sugar and nucleotide sugar metabolism
    LAB52_08510
Enzymes [BR:lay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LAB52_08510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1667356..1668231)
Genome map
AA seq 291 aa AA seqDB search
MKVRKAIIPAAGLGTRFLPATKALPKEMLPIVDKPTIQFIVEEAKASGIEDILIVTGKNK
RAIENHFDSNPELEQDLEKTGKSGLLKLTQEITDLGVNLYYTRQPHPAGLGDAVYRARSF
VAGEPFVIMLGDDLMKDKVPLTKQLINDYDKTHASTIAVMKVPHKEVSKYGVIAPDGKIG
DDLYNVKSFVEKPDVDKAPSDLAIIGRYLLTPEIFDILEHQKPGRGGEVQLTDAIDTMNK
TQRVFAQVFKGQRFDVGNKEGYLETSIQYGLKHPETRDALRKYIKELGKTL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaaaagcgattatccctgcagcaggattaggcactagatttttgccagca
actaaggcattgcctaaggaaatgttgccaattgttgacaagccaacgattcaatttatc
gtggaagaagctaaggcttcaggaatcgaagatatcttgatcgttaccggtaaaaacaag
cgtgcgattgaaaaccacttcgactctaatcctgaattggagcaagacttggaaaagacc
ggtaagtctggtttgctcaagttaacacaagaaattactgatttgggcgtaaacttgtac
tacactcgtcaaccacacccagctggcttgggggatgctgtttatcgtgcccgtagtttc
gttgctggtgaaccatttgtaattatgcttggcgatgatttaatgaaggataaagttcct
ttgactaagcagttaattaacgattacgacaagactcatgcttcaactattgccgttatg
aaagtaccacacaaggaagtttctaagtatggtgtgattgctccagatggcaagattggt
gatgatttgtacaatgtaaagagttttgtagaaaagccagatgttgataaagctccaagt
gatttagcaattattggtcgttacttgttaacacctgaaatttttgatattttggaacat
caaaagccaggtcgtggtggtgaagttcaattaactgacgccattgatacaatgaataag
acacaacgtgtatttgctcaagtgtttaaaggtcaacgtttcgatgttggtaacaaggaa
ggctatcttgaaacttccattcaatatggtttgaagcatccagaaacacgcgatgcttta
cgcaagtacattaaggaattgggtaagacattgtaa

DBGET integrated database retrieval system