KEGG   Lactobacillus amylovorus GRL1118: LAB52_08525Help
Entry
LAB52_08525       CDS       T01954                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lay  Lactobacillus amylovorus GRL1118
Pathway
lay00521  Streptomycin biosynthesis
lay00523  Polyketide sugar unit biosynthesis
lay01130  Biosynthesis of antibiotics
Module
lay_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:lay00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    LAB52_08525
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LAB52_08525
Enzymes [BR:lay01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     LAB52_08525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AEA32622
UniProt: F2M2J8
Position
complement(1669631..1670239)
Genome map
AA seq 202 aa AA seqDB search
MGQIKVEKNVGGIEGLAVITPTVHGDDRGYFMETFNQRDMMEAGFSINFVQDNQSSSTKG
VLRGLHFQKHYPQVKLVRAVRGSVFDVAVDLRSESKTYGKWYGVELTAENKKQFLIPQGF
AHGFLVLSDVAEFCYKVNDFWHPNDEGGMAWNDPEIGIEWPHLKGDYPGSADASGYTLDD
GTKLNMAERDQEWKGLKDTFKF
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgggacaaattaaagttgaaaagaatgtcggtggaatcgaaggtttagcagttattaca
ccaactgttcacggtgatgaccgtggttacttcatggaaacttttaaccaaagagacatg
atggaagccggctttagtattaacttcgtgcaagacaaccaatcaagttcaactaagggt
gttcttcgtggtttacacttccaaaagcattacccacaagttaagttagttcgtgctgta
cgtggtagcgtatttgacgtggccgttgaccttagaagtgaatcaaagacttacggcaag
tggtacggtgttgaattaactgcagaaaacaagaagcaattcttgatcccacaaggtttt
gcacatggctttcttgtattgagtgatgttgctgaattctgctacaaggttaacgacttc
tggcacccaaacgatgaaggtggtatggcttggaacgatcctgaaattggtattgaatgg
ccacatcttaagggtgactatccaggtagcgcagatgctagtggttacactttagacgat
ggtactaagttgaacatggcagaacgtgaccaagaatggaaaggtttgaaagataccttc
aagttttaa

DBGET integrated database retrieval system