KEGG   Leptotrichia buccalis: Lebu_0028Help
Entry
Lebu_0028         CDS       T00975                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
lba  Leptotrichia buccalis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lba00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(32091..33578)
Genome map
AA seq 495 aa AA seqDB search
MRKGKVYIAGAGCGDEGLITLKLKNVIEKADCIVYDRLVNENILQYAKSDVEMIYMGKEN
TAGGKLQAEINKKLVEKGKEGLAVLRLKGGDPFVFGRGGEEIEALVAENIDFEVIPGITS
SIAVPAYAGIPVTHRGINTSFHVFTGHTQFNGIELDFPVIAKLEGTLVFLMGLSNLEKIA
ENLINNGKNPKTPVAIIKDGTTTRQKTYTGTLETIVNTVKEHNVKSPAIILIGEVVNLRE
NMKWFENKPLFGKNILVTRNREKQGNISNKINELGGQALSLPFINIEYVDFEMPDLKEYS
TLLFNSINSVIGFMRKVKDIRSLGNVKIGVVGEKTAEEIEKYKIIPDFYPEEYTVERLAN
ESVNFTKEGEKILFIVSDISPVNEKKYSNLYNRNYEKLVVYKTQKVEVEKEKAEKYIKES
DILMFLSSSTFKAFADSINLSENEEIKEILKNKIIASIGPVTTKTIEKYGLKVEIEPKKY
TEEGLFEKILKFINN
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaggtaaagtttatattgcaggagcaggctgtggagacgaggggcttataact
ttaaaattgaaaaacgtgatagaaaaagcggactgcattgtttatgacagacttgtaaat
gaaaatatcttacagtatgcaaagtctgatgtggaaatgatttatatggggaaagaaaat
actgctggaggaaaattacaggcagaaataaataaaaaattagtagaaaaagggaaagaa
ggacttgcggttctaagattaaaaggaggagatccttttgtatttggacgaggaggagaa
gaaatagaggctttagttgctgaaaatatagattttgaggtaattccagggataacttct
tcaatcgctgtgccagcttatgctggaattcctgttactcacagaggaatcaatacttct
tttcatgtgtttactggacatacgcaatttaatggaatagaacttgattttccagttatt
gcaaaattggaaggaactttggtctttctaatgggattaagcaatcttgaaaaaatagca
gaaaacttgataaataacggaaaaaatccaaaaacacctgttgcaataataaaagatgga
acaacgacaagacagaaaacttacacaggaacattggaaacaatagtaaatacagtaaaa
gagcataatgtaaaatcacctgccattattttaattggagaagtagtaaatttacgggaa
aacatgaaatggtttgagaataagccgttatttggaaaaaatattcttgttacaagaaat
agggaaaaacaaggaaatatatcaaataaaataaatgaacttggcggacaggctttgagc
cttccatttattaatatagaatatgtcgattttgaaatgcctgatttgaaggaatacagt
acccttctatttaacagcataaattctgttattggatttatgagaaaagtaaaggatatt
cgttctttgggaaatgttaaaataggtgtagtgggagaaaaaactgctgaagaaattgaa
aaatataaaataattccagatttttatccagaagaatacacggtagaaagactggctaac
gaaagtgtgaattttactaaggaaggagaaaaaatactatttatagtatctgatatttct
ccagtaaatgaaaaaaaatattcaaatttatataaccgaaattatgaaaaacttgtagtg
tataaaactcagaaagttgaagtggaaaaggaaaaagctgaaaaatacataaaagaaagc
gacattttaatgtttttaagttcatcaacttttaaagcctttgctgatagcataaacttg
agtgaaaatgaggaaataaaagaaattctgaaaaataaaattatagcctcaattggtcct
gttactacaaaaactattgaaaaatatggattaaaagtagagatagagccgaaaaaatat
acggaggaaggattatttgaaaaaatattgaaatttattaataattaa

DBGET integrated database retrieval system