KEGG   Leptotrichia buccalis: Lebu_0154Help
Entry
Lebu_0154         CDS       T00975                                 

Definition
type III restriction protein res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
lba  Leptotrichia buccalis
Brite
Enzymes [BR:lba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Lebu_0154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
156791..159859
Genome map
AA seq 1022 aa AA seqDB search
MSNKIIFQFDDNLEYQKKAVNSVVELFRGLPKSLDNIYAERIRKTRLMEKDPVRNIDIVR
GNKLFQNLKKVQLKNGLFTNEKAYSKHERDFTVEMETGTGKTYVYLRTILELHKEYGFKK
FMIVVPSVAIRKGVEKSIEQLREHFKRLYNVDLSKYSFIYDSNNLGKVNNFVEENNLSIC
VMNIQAFNKDTNKIRKDDEYDKNLWRDIKFVRPIVLIDEPQKIEGTANKKSQSLKAIDEL
EPLFTLRYSATHKNLYNQVYKLDSYEAYKKDLVKKIRVKTINSVISKDFPYIRYTYFTKD
YKARIEMFSQEQGQSIRFRSFDVENGFSLYELSGGLPQYKDMFIAEQPHKEKALKIASVN
GDIELKLGESNKKLEDKEIIRIQINLAIDNHFKKQFEILEEGKRIKSLTLFFIDEVKKVR
DSGASDGRGVYLKIFDEEYLKIVQKYREKIEKYKNYFPHYEDVNLVREGYFALDKKKKEV
EVEYKKENEVKAKSQEDIDRGIELILEKKDELISFNEPLAFIFSHSALREGWDNPNVFTL
CTLKNGSSDIAKKQEIGRGLRLPVDVNGNRSLDKNVNELTVIANDSYENFSRMLQEDFNK
NINKNEVTSDLLLITLEKSGIPKIKITSELVDEFKKELIENKVMDSNNVLLKKTEEIDVK
KIEFSNETLKEHSIQIAENFVKYMVEKGSNRIEIANGDNEPIINKRRTFISEKDFENLFE
ELGTNLSKKAIYRCKIDNEKYIESSIKKINNYISNFDLKQIVEVAESKGDYDETGNFNLE
KDSSDKEIEISKIEVAPKSDFEIANYIMYHTMLPRLAILKIISGLEKEKREALNIQDVLE
NVTEILLENLNEMKAEKVFEYEVIDGYVTDTEKIFEVDNKINEEDFENKRRLFQAKKGSR
SLSDYYKLDSDGEKEFAEKLENDENVLLFTKLKKGGFVIDTPYGNYSPDWAIIYRNSSEN
NENNVGIYFIVETKADKEEKDLTTVEKSKIKCGKLHFEAISKEVKFNWVNNYDDFRRKFE
IK
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaataaaataatatttcagtttgatgataatttggaatatcagaaaaaggcggta
aactctgttgtagagttatttagaggattgccaaaatcgttggataatatttatgctgaa
agaataagaaaaacaagacttatggaaaaagatcctgtgagaaatattgatattgttaga
gggaataaactttttcagaatttgaaaaaagttcagttgaaaaatggactgtttaccaat
gaaaaggcttacagcaagcacgagcgagattttacagtcgagatggaaactggaactggg
aaaacttatgtttatttgcgtacgatattggagttgcacaaggagtatggatttaagaaa
tttatgattgtagttccatctgttgcgattcgtaaaggggtggaaaaatctattgaacaa
ttaagggagcattttaaaaggctatacaatgtggatttatcaaaatacagttttatttat
gacagtaataatttaggaaaagtaaataattttgtggaagagaataatttgagtatctgt
gttatgaatattcaagcgtttaataaagatacgaataaaattcgtaaggatgatgaatat
gataaaaatttatggagagatataaaatttgtaaggccgattgtgttaattgatgagcca
cagaaaatagaaggaacagcaaataaaaaatctcaatcattgaaggcaatagatgaacta
gagccgttatttacacttcgttattcggctacacataaaaatctgtataatcaagtttat
aaattagattcttatgaggcgtataaaaaagacttagtaaaaaaaattcgggtaaaaaca
ataaatagtgtgatttctaaagattttccatatattagatatacttattttacaaaagat
tacaaggcaaggatagaaatgttttctcaagagcaagggcaaagtatcagatttagaagt
tttgatgtggaaaatggtttttcgttgtatgaactttctggaggattgcctcagtataag
gatatgtttattgcagaacagccacataaagagaaggcattgaaaattgcttcggttaat
ggagatattgaactgaaattgggggaaagtaataaaaaattggaagataaggagattatc
cgtattcagataaatcttgcgatagacaatcactttaaaaagcagtttgaaattttggaa
gaagggaagagaataaagagtttgacactgttttttattgatgaggttaagaaagttagg
gatagtggggcttctgatgggagaggagtctatttgaaaatatttgacgaagaatattta
aaaattgtgcaaaagtatagggaaaaaattgagaaatataaaaattattttccacattat
gaagatgtgaatttagtgagagaaggatattttgcattggataagaaaaaaaaggaagtt
gaggtggaatataagaaagaaaacgaagtgaaggcaaaatcgcaagaagacattgacaga
gggattgaattaatactggagaaaaaagatgagctgatttcatttaacgagccacttgcc
tttattttttctcattcggcacttagggaaggatgggataatccgaatgtgtttacattg
tgtacattgaaaaatggaagtagcgatatagccaaaaagcaggaaataggtaggggactt
agacttcctgtagatgttaatggaaatagaagtttagataaaaatgtaaacgaacttact
gtaattgcaaatgacagctatgaaaacttttcaagaatgctacaggaagattttaacaaa
aatataaataaaaatgaagttacatcggatcttttacttattacacttgaaaaatcagga
attcctaaaataaagattacttcggaactggtggatgaatttaagaaggaattaatcgaa
aataaagtgatggattctaataatgtcctattaaagaaaacagaagaaatagatgttaaa
aaaattgaattttcaaatgaaactttgaaagaacattctatacaaattgctgaaaatttt
gtaaaatatatggtggaaaaaggttcaaatcgtatcgaaattgcaaatggagataatgaa
ccgattattaataaaagaagaacatttatttctgaaaaagattttgaaaatctttttgaa
gaattagggacaaatcttagtaaaaaagcgatttataggtgtaaaatcgataatgaaaaa
tatatagaaagtagtataaaaaaaataaataactacataagcaattttgatttgaaacaa
attgtggaagtagcagaatctaaaggagattatgatgagacaggaaattttaatcttgaa
aaagacagtagcgacaaagaaatagaaatatctaaaattgaagtggctccaaaaagtgat
tttgaaatagcaaattacataatgtatcacacaatgctcccaagattagcaatattaaaa
ataataagtggacttgaaaaagaaaaaagagaagcattgaatattcaagatgtgctggaa
aatgtaactgaaatattgcttgaaaacttaaatgaaatgaaagctgaaaaagtttttgaa
tatgaagtgatagatggatatgtgactgatacagagaaaatctttgaagtggacaataaa
ataaacgaagaggattttgaaaataaaagaagattattccaagctaaaaaaggtagtaga
agtttaagtgattattataaacttgatagtgatggtgaaaaggaatttgcagaaaaattg
gaaaacgatgaaaatgtattgttatttacaaaactcaaaaaaggtggctttgtaatagat
actccatacggaaactattctcccgactgggcaatcatctacagaaattcttcagaaaat
aatgaaaacaatgtaggaatctattttatcgttgaaacaaaggcagataaagaagaaaag
gatttgacaactgtggaaaaaagcaaaataaaatgtggaaaactgcattttgaagcgatc
tcgaaggaggtgaaatttaactgggtaaataattacgatgattttagaagaaaatttgaa
attaaataa

DBGET integrated database retrieval system