KEGG   Leptotrichia buccalis: Lebu_0476Help
Entry
Lebu_0476         CDS       T00975                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lba  Leptotrichia buccalis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lba00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Lebu_0476
Enzymes [BR:lba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Lebu_0476
Exosome [BR:lba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Lebu_0476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
508125..509642
Genome map
AA seq 505 aa AA seqDB search
MDNQKKYIIALDQGTTSSRAIIFDKNLNIIEKAQKEFTQIFPQPGWVEHNAMEIWASQRS
VLTEVIAQSGISLKDVAAIGITNQRETVIVWDKNTGEPVYNAIVWQCRRTAEICEELKNR
GLEDYVNENTGLIIDAYFSGTKVKWILDNVKGAREKAENGELLFGTVDTWLVWKLTGGKV
HVTDFTNASRTMLFNIKNLEWDKKILKELNIPESMLPEVRNSSEIYGKTRMGITIGEENG
TSIPISGIAGDQQAALFGQAGFHTGDIKNTYGTGCFMLMNTGNKCIKSNNGLLTTIAIGI
DGKVEYALEGSIFIGGAVIQWFRDELRFFDKASDTEYFAQQVDDNGGVYLVPAFVGLGSP
YWDMYARGTIVGLTRGSNKNHIIRAALESIAYQSKDLINAMKEDSGIEINSLKVDGGATA
NNFLMQFQSDILNTKVLRPEIIETTALGAAYLAGLAVGFWKNKEEIKKNWRLNKEFLPNL
SENLRKKYYKCWKKAVEKAKSWEED
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggataatcaaaaaaaatatataatcgctctagatcaaggaacaactagctcacgtgca
attatttttgataaaaatttgaacattattgagaaagctcaaaaggaatttacacaaatt
ttcccgcaaccagggtgggttgagcataatgctatggaaatatgggcaagccagcgttcc
gttcttaccgaagttatcgcacaatctggaatttctctaaaggacgttgcagcaattgga
attacaaatcaaagggaaactgtaatcgtgtgggataaaaatactggcgagcctgtctat
aacgcaattgtctggcaatgcagacgaacggctgaaatttgcgaagaattgaaaaatcgt
ggactcgaagattatgtaaacgaaaatacaggactgataatcgatgcttatttttctggg
acaaaagtaaaatggattcttgacaatgtgaaaggtgcaagggaaaaggctgaaaatggg
gaactgctttttggaacggttgatacttggctcgtgtggaaactaactggcggaaaagtg
catgttactgattttacaaatgcttccagaactatgctttttaacataaaaaatttagaa
tgggacaaaaaaattttaaaggagcttaatattccagaaagtatgcttccagaagttaga
aattcaagtgaaatttatggaaaaacaagaatgggaattacaattggtgaagaaaacggc
acttctattccaatttcaggcatcgctggagatcagcaggcggcgttgtttgggcaggct
ggatttcatactggagatataaagaatacttacggaacaggctgctttatgcttatgaat
acaggaaacaaatgtataaaatcaaataatggcttacttacaactattgccattgggatt
gatggaaaagtggaatatgctctggaaggaagtatttttattggtggggctgttatccag
tggtttcgtgatgaattaaggttttttgacaaggcttctgatacagaatactttgcacag
caagttgatgataatggtggagtttatctagttccagcatttgttggattaggctcgcca
tactgggatatgtacgcccgtggtacaatcgttgggcttacccgtggatctaataaaaat
cacataattcgtgctgccctcgaatccatcgcctaccagtcaaaagacttgataaacgca
atgaaagaagattcaggtattgaaataaattctctaaaagtcgatggtggtgcaacagca
aacaatttcctaatgcaatttcaaagtgatattttaaatacaaaagttttacgtcctgaa
attatcgaaacaactgcattaggcgctgcatatttagctggactcgccgttggattttgg
aaaaataaagaagaaatcaaaaagaactggcgtttaaacaaagaatttttaccaaattta
tctgaaaatttaaggaaaaaatattataaatgctggaaaaaggcggttgaaaaggctaaa
agctgggaagaagattga

DBGET integrated database retrieval system