KEGG   Leptotrichia buccalis: Lebu_0487Help
Entry
Lebu_0487         CDS       T00975                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lba  Leptotrichia buccalis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lba00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Lebu_0487
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Lebu_0487
Enzymes [BR:lba01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Lebu_0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
519600..520868
Genome map
AA seq 422 aa AA seqDB search
MVDGFRITGKTPLNGVIKVSGAKNAALPIIIATLVAKGEYILKNVPNLRDIRVTMKLLED
LGMITEKLDNNTYKIINNGFKRTEASYQIVKQMRASFLVMGPMIANLDEAVVSLPGGCAI
GSRPVDLHLKGFEMLGADITRVHGYVHAKSDNLKGAEIPLGFPSVGATQNIMMAAVKTPG
KTIISNAAREPEIVDLGNFLNKMGAKITGLGTPNIEIEGVEELHAVEYSIMPDRIEAGTY
VIAALVTEGDLKIQDARLEDLGVFKSELEAMGVKFKQDGDILSVIGKVKDLKPSKIKTLP
HPGFPTDMQPQMMLLQTLVNGGSSMEETVFENRFMHVPEFNRMGADITIRHGVAFVNGGL
PLTGAEVMSSDLRAGAALVLAALAADGETIVNRVYHIDRGYDRLELKLNTVGAKIERIKL
DI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtggttgatggatttagaataacaggaaaaacgcctttaaacggagtaataaaagtaagt
ggagctaaaaatgcagctcttccaataattatcgcaactcttgttgcaaaaggggaatat
atcttaaaaaatgttccaaacttgagagatattagagtaacaatgaaattgcttgaagat
ttgggaatgataactgaaaaattagataacaatacttataaaattataaacaatggcttt
aaaagaactgaagcaagctatcagattgtaaaacagatgagagcctcatttttagtaatg
ggaccaatgattgcaaatttagatgaagcagtagtttcacttcctggaggatgtgcaata
ggttcaagacctgtcgatttacatttaaagggatttgaaatgctaggtgccgatattacg
agagtacacggatatgttcacgcaaaatctgataatttaaaaggagccgaaattccttta
ggtttcccaagtgtaggagcaacacagaatatcatgatggcagctgtaaaaacacctggt
aaaactatcatttcaaatgcagcaagagagcctgaaatcgttgatttaggaaatttctta
aataaaatgggagcaaaaattacaggacttggaacaccaaacattgaaattgaaggagtg
gaagagcttcatgcagtagaatattcaattatgccagatagaattgaagcaggaacttat
gtaatagcagcactagttacagaaggagatttaaaaattcaggatgcaagacttgaagat
ttgggagtatttaaatccgaacttgaagctatgggcgtaaaattcaaacaggatggagac
atattatctgtaatcggaaaagtgaaagatttgaagccatcaaaaataaaaacattgccg
catccaggatttccaacagatatgcagcctcaaatgatgttattacaaacattagtaaat
ggtggaagctcaatggaagaaactgtctttgaaaacaggtttatgcatgtgcctgaattt
aacagaatgggtgcagatattacgataagacatggagttgcttttgtaaatggaggattg
ccattaactggagcggaagtaatgtcttcggatttacgagcaggagctgcactggttctg
gcggcacttgcggcagatggagaaacaattgtaaacagagtttatcatattgacagaggt
tatgacagactggaactgaaattaaacactgttggagcaaaaattgaaagaatcaaacta
gatatttaa

DBGET integrated database retrieval system