KEGG   Leptotrichia buccalis: Lebu_0487Help
Entry
Lebu_0487         CDS       T00975                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lba  Leptotrichia buccalis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lba00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lba00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
519600..520868
Genome map
AA seq 422 aa AA seqDB search
MVDGFRITGKTPLNGVIKVSGAKNAALPIIIATLVAKGEYILKNVPNLRDIRVTMKLLED
LGMITEKLDNNTYKIINNGFKRTEASYQIVKQMRASFLVMGPMIANLDEAVVSLPGGCAI
GSRPVDLHLKGFEMLGADITRVHGYVHAKSDNLKGAEIPLGFPSVGATQNIMMAAVKTPG
KTIISNAAREPEIVDLGNFLNKMGAKITGLGTPNIEIEGVEELHAVEYSIMPDRIEAGTY
VIAALVTEGDLKIQDARLEDLGVFKSELEAMGVKFKQDGDILSVIGKVKDLKPSKIKTLP
HPGFPTDMQPQMMLLQTLVNGGSSMEETVFENRFMHVPEFNRMGADITIRHGVAFVNGGL
PLTGAEVMSSDLRAGAALVLAALAADGETIVNRVYHIDRGYDRLELKLNTVGAKIERIKL
DI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtggttgatggatttagaataacaggaaaaacgcctttaaacggagtaataaaagtaagt
ggagctaaaaatgcagctcttccaataattatcgcaactcttgttgcaaaaggggaatat
atcttaaaaaatgttccaaacttgagagatattagagtaacaatgaaattgcttgaagat
ttgggaatgataactgaaaaattagataacaatacttataaaattataaacaatggcttt
aaaagaactgaagcaagctatcagattgtaaaacagatgagagcctcatttttagtaatg
ggaccaatgattgcaaatttagatgaagcagtagtttcacttcctggaggatgtgcaata
ggttcaagacctgtcgatttacatttaaagggatttgaaatgctaggtgccgatattacg
agagtacacggatatgttcacgcaaaatctgataatttaaaaggagccgaaattccttta
ggtttcccaagtgtaggagcaacacagaatatcatgatggcagctgtaaaaacacctggt
aaaactatcatttcaaatgcagcaagagagcctgaaatcgttgatttaggaaatttctta
aataaaatgggagcaaaaattacaggacttggaacaccaaacattgaaattgaaggagtg
gaagagcttcatgcagtagaatattcaattatgccagatagaattgaagcaggaacttat
gtaatagcagcactagttacagaaggagatttaaaaattcaggatgcaagacttgaagat
ttgggagtatttaaatccgaacttgaagctatgggcgtaaaattcaaacaggatggagac
atattatctgtaatcggaaaagtgaaagatttgaagccatcaaaaataaaaacattgccg
catccaggatttccaacagatatgcagcctcaaatgatgttattacaaacattagtaaat
ggtggaagctcaatggaagaaactgtctttgaaaacaggtttatgcatgtgcctgaattt
aacagaatgggtgcagatattacgataagacatggagttgcttttgtaaatggaggattg
ccattaactggagcggaagtaatgtcttcggatttacgagcaggagctgcactggttctg
gcggcacttgcggcagatggagaaacaattgtaaacagagtttatcatattgacagaggt
tatgacagactggaactgaaattaaacactgttggagcaaaaattgaaagaatcaaacta
gatatttaa

DBGET integrated database retrieval system