KEGG   Leptotrichia buccalis: Lebu_0682Help
Entry
Lebu_0682         CDS       T00975                                 

Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lba  Leptotrichia buccalis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lba00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lba00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
751407..751928
Genome map
AA seq 173 aa AA seqDB search
MFSLIVAVGENNEIGKNNQLLWHIPEDLKNFKKITMGKTVIMGKNTYKSIGKPLPNRKNI
VLSRNPLEIEEKIKEDRKKYENENTKLELCDNLQKIIDKYKNSEEEIFIIGGGEIYKKAF
EMKIVKRIYMSHVNFSDKNADTYFPKIDLKKWVVITKENYDGWRFCIYEKISG
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgtttagtttaatagttgccgttggggaaaataatgaaattggaaaaaataatcaactt
ctttggcatattcctgaggatttgaaaaattttaagaagataactatgggaaagacagtc
ataatggggaaaaatacctataaaagcataggaaaacctttgccaaacagaaaaaatatt
gtgctttcaaggaatccgttagaaatagaagaaaaaataaaagaagatagaaaaaaatat
gaaaatgaaaatacaaaattagaactttgtgataatttgcaaaaaattattgataaatat
aaaaattctgaagaagaaatttttattattggtggaggagagatttataaaaaagctttt
gaaatgaaaattgtaaaaagaatttatatgagccacgttaatttttctgataaaaatgca
gatacttattttccaaaaattgatttaaaaaaatgggtagttataacaaaagaaaattat
gatggctggagattttgtatttatgaaaaaattagtggataa

DBGET integrated database retrieval system