KEGG   Leptotrichia buccalis: Lebu_0704Help
Entry
Lebu_0704         CDS       T00975                                 

Definition
polar amino acid ABC transporter inner membrane protein
Orthology
K17073  
putative lysine transport system substrate-binding protein
K17074  
putative lysine transport system permease protein
Organism
lba  Leptotrichia buccalis
Pathway
ABC transporters
Module
Putative lysine transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:lba02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
772685..774250
Genome map
AA seq 521 aa AA seqDB search
MKFSTIKNKILTLLVFIATFVTGYSDDIKVGMECGYAPFNWFQNDAKRGAVKVDGGYCGG
YDVEIAKVIAKKLNKNLVIVKTEWDALLGPAINSGKVDLVIAGMSATPERRQSLAFSKSY
YESDLVVVVKKNGKYANAKSINDFAGAKITGQLNTLHYDVIDQMKGVQKQTAMENFPAMI
VALNSGKIDGYISERPGAMAAQFSNPDLKFISFDKNTGFKYDTAEVNVAVGMKLGNTELE
EKVNKILDEDLTPKVRQEIMEKAIQNQPGGNSRSFTGWVTYFIQKNWKEFVKGTLVTLFI
SITGTVVGFLIGLVVALFRHSESETDEQTQKYKKYGLKFINTLSSVYIAVFRGTPMIVQS
MVIYYGLSQVFNINLSPMVAALFIVSINTGAYMSEIIRGGIDSIDNGQFEAAKAIGMTNF
QLMQSIIFPQMFRNILPMIGNELIVNIKDTSVLNVISVTELFFISKSVAGTYSRYYEVFI
ITSVIYFFLTFTLSLILKQIEKRIDGPQHFEFLDDTDGEEK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttagtacaataaaaaataaaatattaacattattagtttttattgcaactttc
gtaacaggttatagtgatgacataaaagttggaatggagtgtggatatgctcctttcaac
tggtttcaaaatgatgctaaacgtggtgctgtgaaagtggatggaggttattgtggcgga
tatgacgttgaaatagccaaagttattgcgaaaaagctaaataaaaatctagtaattgta
aaaacggaatgggatgctttgcttggacctgcaattaattcgggaaaagttgacttggtt
atagcgggaatgtctgcaacaccagaaagacgtcaaagcctagctttttcaaaatcgtat
tatgaatcagatttggtagtagttgtgaaaaaaaatggaaaatatgcaaacgctaagtcg
attaatgattttgcgggagcgaaaatcacaggacagttaaatactcttcattatgatgtt
attgatcagatgaagggggtacaaaagcaaactgcaatggaaaattttccagcgatgata
gttgccttaaattccgggaaaattgatggatatatatcggaaagaccaggagcaatggca
gcgcaattttcaaatccagatttaaaatttatttcatttgataaaaatacaggatttaag
tacgatacagcagaagtaaatgttgcagtcggaatgaaattgggaaatacagagctagaa
gagaaagttaataaaattttggatgaggatttgactccaaaagtgcgacaggaaataatg
gaaaaggctatacaaaatcagccaggtggaaattcgcgttcatttactggatgggtaact
tactttattcaaaaaaactggaaagaatttgtaaaagggacacttgtaactttatttatt
tcgattacaggtacagtagttggatttttgattggtctagtagttgcgttatttagacat
tcggaatctgaaactgatgagcagacacaaaaatataaaaaatatggacttaaatttata
aatacactttcatcagtttatattgccgtatttagaggaaccccgatgatagtacagtca
atggtaatttactatggactatctcaggtattcaatataaatttatcgccaatggtagcg
gcattatttattgtatcaataaatacaggtgcatatatgagtgaaattatccgtggagga
attgattcaattgacaatggacagtttgaagcggcaaaagctattggaatgacaaatttt
cagttaatgcaaagtattatttttccacagatgtttagaaatattttaccaatgattgga
aatgagcttattgtaaatattaaagatacatctgtattaaatgtgataagtgtgacagag
ttgttctttatttcaaaatctgttgcaggaacttactcacgttattatgaagtatttatt
ataacaagtgtgatttatttcttcctgacatttacattatcattgattttaaaacaaatc
gaaaaacgaattgacgggcctcaacattttgagtttttggatgatactgatggggaggag
aaataa

DBGET integrated database retrieval system