KEGG   Leptotrichia buccalis: Lebu_0875Help
Entry
Lebu_0875         CDS       T00975                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lba  Leptotrichia buccalis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lba00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Lebu_0875
DNA repair and recombination proteins [BR:lba03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Lebu_0875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
956910..957506
Genome map
AA seq 198 aa AA seqDB search
MKKLDDLIDVFAKLPGIGRKSAARIAFDVLEKSEADIDRMLEIIKDSHTNIKHCEICGNL
SENDICEICANEKRDKEVICVVEGVRDVIAFEKSETYNGLYHVLGGKIDPLNGVTIEDLN
LMKLMRRLDGNVKEIILALNPDLEGETTSLYLTKFLKDKNVKISKIASGIPMGGNIEYTD
MATLGRSLEGRVNVDDVD
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaacttgatgatttgatagatgtttttgcaaaattaccgggaattggaagaaaa
agtgcggcaagaattgcatttgatgtgcttgaaaaaagtgaagctgatattgatagaatg
cttgaaataataaaagattcacatactaatattaaacattgtgaaatttgtggaaattta
tcggaaaatgatatttgtgaaatttgtgccaatgagaaaagagacaaggaagtaatctgt
gttgttgaaggagtgcgagatgtgattgcatttgaaaagtctgaaacttataatggactt
tatcacgtacttggcggaaaaattgatccattaaatggagttactattgaagatttaaac
ttaatgaaattaatgagaaggttggatggaaatgtgaaagaaattatattagctttaaat
cctgatttggaaggggaaactacaagtctctatttgacaaaatttttaaaagataaaaat
gtaaaaatttcaaaaattgccagtggaattccaatgggaggaaatattgaatatacagat
atggcgacgctgggaagatcgctggaaggtagagttaatgtggatgatgtagactag

DBGET integrated database retrieval system