KEGG   Leptotrichia buccalis: Lebu_0876Help
Entry
Lebu_0876         CDS       T00975                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lba  Leptotrichia buccalis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lebu_0876
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lebu_0876
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Lebu_0876
Enzymes [BR:lba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Lebu_0876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(958012..959505)
Genome map
AA seq 497 aa AA seqDB search
MNYKSTRGGKVQSSTFATLHGLANGGGLYIPEKLPEVKLTYDELKDLSYQELSEKIIKLF
FTEFSDEEIKNAVNNAYNNTTFTDENIVPVHKLNEKVSFGELFHGRTLAFKDLALSLFPY
LLLLSKEKQKEDKKILILAATSGDTGKAALEGFKNVDGINIVVFYPKNGVSPMQEEQMRK
QLGNNVEIVAINGNFDDAQSAIKVIFSSEEFKKYANDHNVMFSSANSINIGRLFPQIIYY
VSTYVNLVKAGTIKPNEEFNVVVPTGNFGNILAGFIAKKLGIPIKKFISASNKNKVLADF
FQTGIYNKNRDFYATNSPSMDILLSSNFERYLYYALNENSERVNELITNLLLGGELSVNE
EELKNIQNEFYGEFANDDETVNAIKNVYENYHYLMDPHTAVAYSVYEKLDNNNLDKNIHT
VIMSTAHPFKFPTPIAKALGLDETKEPYAILDEVSKVTGVKFPEKLTEVRNSEIRFSNVI
DKAEIQDFVKKYINDLK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaattacaaaagtacaagaggcggaaaagtacaaagctccacttttgctacattacat
ggacttgcaaatggcggcgggctttatatccctgaaaaattaccagaagttaaattgact
tatgatgaactaaaagacttgtcttatcaagaactttcagaaaaaattataaaactattt
tttacagaattttcagacgaagaaataaaaaatgctgtgaacaatgcttataacaatact
acttttactgatgaaaatattgttcctgtacataaattaaatgaaaaagtaagttttgga
gaactgtttcatggaagaacattggcatttaaagatttggctctttcattattcccatat
ttgctgcttttaagtaaagaaaaacaaaaagaagataaaaaaatattgattctggctgca
acttctggagatactggaaaggctgcacttgaaggatttaaaaatgttgacggaattaac
attgtcgtattttatcctaaaaatggagttagtccgatgcaggaagaacaaatgcgaaaa
cagcttggaaacaatgtcgaaattgtcgcaataaacggaaactttgatgatgctcaaagt
gccataaaagtcattttttccagcgaagaatttaaaaaatatgcaaacgatcacaatgta
atgttttcaagtgcaaactctatcaatattggaagattatttccacaaatcatatattat
gtgtcaacttatgtaaacttggtaaaagctggaacaattaagcctaacgaggaatttaat
gtggtagttccaactggaaactttggaaatattttagctggatttatcgctaaaaaactt
gggataccaatcaaaaaatttatttcagcttcaaataaaaataaagttctggctgacttc
ttccaaactggaatatacaacaaaaatagagatttttacgcaacaaactcaccttcaatg
gacattcttctttcatcaaattttgaaagatatttatattacgcactaaatgaaaattct
gaaagagtaaatgaattgattacaaacttacttttaggaggagagttgtctgtaaatgaa
gaagaattgaaaaatattcaaaatgaattttacggagaatttgcgaacgatgatgaaact
gtaaatgcaattaaaaatgtatatgaaaattatcattatttaatggatcctcacacagca
gttgcttattctgtttatgaaaaattagataacaacaatttagataaaaacattcacaca
gtaataatgtcaacagcacacccattcaaattcccaactccaattgcaaaagcattggga
cttgatgaaacaaaagagccttatgcaattttagatgaagtatcaaaagttactggtgta
aaattcccagaaaagctgacagaagtcagaaattcagaaataagattttcaaatgtaatt
gataaggctgaaattcaggactttgtgaaaaaatatataaacgatttaaaataa

DBGET integrated database retrieval system