KEGG   Leptotrichia buccalis: Lebu_1037Help
Entry
Lebu_1037         CDS       T00975                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lba  Leptotrichia buccalis
Pathway
lba00010  Glycolysis / Gluconeogenesis
lba00052  Galactose metabolism
lba00500  Starch and sucrose metabolism
lba00520  Amino sugar and nucleotide sugar metabolism
lba00521  Streptomycin biosynthesis
lba01100  Metabolic pathways
lba01110  Biosynthesis of secondary metabolites
lba01120  Microbial metabolism in diverse environments
lba01130  Biosynthesis of antibiotics
lba01200  Carbon metabolism
Module
lba_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lba_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lebu_1037
   00052 Galactose metabolism
    Lebu_1037
   00500 Starch and sucrose metabolism
    Lebu_1037
   00520 Amino sugar and nucleotide sugar metabolism
    Lebu_1037
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Lebu_1037
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Lebu_1037
Enzymes [BR:lba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Lebu_1037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ACV38937
JGI: Lbu_1037
UniProt: C7N9V6
Position
1130261..1131205
Genome map
AA seq 314 aa AA seqDB search
MKYYVGIDLGGTNTKIGLVDEKGNIIFTTIVKTDSMEGFSETIQRLSKILITQIEGSNVN
FDNVVSVGVGVPGPVLNSRVVKFWANFPWKNGVDLALEFEKNLGKPVKADNDVNVITLGE
MWQGAAQGYKNVLGLAVGTGIGGGIIVDGKLVSGEHGAGGEVGHIKIEPNGKLCGCGQKG
CWEAYASATGIIREANSRLAVSKQNLLYEMTKGRELEAKDVFDAAKKGDEFSLDIVDYEA
EKLAFGIGNLLNILDPEIVVVGGGVALAGDILFDRVKEKLKDVAFPSTLENLKIVAATLG
NDAGILGAAYLGMM
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattatgtaggaattgatttgggaggaactaataccaagattgggcttgtggat
gaaaaggggaatattatttttactaccattgtaaaaactgattcaatggaaggtttttct
gaaacaattcaaagattgtcaaaaattttaattactcaaattgaaggaagtaatgttaat
tttgataatgttgtgtcagttggagttggagtaccaggacctgtgttaaattccagagtt
gttaagttctgggcgaattttccttggaaaaatggagtggatttggcattggaatttgaa
aaaaatcttggtaagccagtaaaagcggataatgatgttaatgtaattacacttggagaa
atgtggcaaggtgctgcccaaggatacaaaaatgttttaggacttgctgttggaactgga
attggtggtggaattattgttgatggaaaacttgtcagcggagaacatggagcaggtgga
gaagttggacatattaaaattgagccgaatggtaaattatgcggatgcgggcaaaaagga
tgctgggaagcctatgcttctgctacaggaataatccgtgaagcaaacagccgtcttgca
gtaagtaaacaaaatttactttatgaaatgacaaaaggcagagagctggaagcaaaggat
gtatttgatgcagctaaaaaaggtgatgaattttcgcttgacattgtagattatgaagcg
gaaaaacttgcttttggtattggaaatctgcttaacatactagatcctgaaattgtagta
gttggtgggggagttgcacttgctggagacattttatttgatcgtgtaaaagaaaaatta
aaggatgtggcgttcccatcaactttagaaaatttgaaaattgttgctgcaactcttgga
aatgatgctggaattttaggagctgcataccttggaatgatgtaa

DBGET integrated database retrieval system