KEGG   Leptotrichia buccalis: Lebu_1249Help
Entry
Lebu_1249         CDS       T00975                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
lba  Leptotrichia buccalis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Lebu_1249
Enzymes [BR:lba01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Lebu_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1335462..1336058)
Genome map
AA seq 198 aa AA seqDB search
MTENKNLDIDKKTRLENIENAVRKILINIGEDINREGLIETPKRVAKMYEEILSTKSIND
FDNYKLFEVDLDNSQEMILIKDIPFFSMCEHHMLPFFGKVHVAYIPRENKVIGLSKIPRL
VEFVSRKLSVQEEITVNVAKKLIEILNPLGVAVVVEARHMCIEMRGINKIGSVTKTSFYS
GEFKVNVDRKKEFLDGIK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaataaaaatttagacatagacaaaaaaaccagattagaaaatatagaaaat
gcagtgcgaaaaatattgataaatattggtgaagatattaatagagaaggtcttattgaa
acaccaaaaagagttgcgaaaatgtatgaagaaattttgagtacaaaaagtataaatgat
tttgataattataaattatttgaagttgatttagataattcacaggaaatgatacttata
aaggatataccatttttttcaatgtgtgagcatcatatgttgcctttttttggaaaagtt
cacgttgcatatattccaagagaaaataaagttattggacttagcaagataccaagactt
gtggaatttgtttcacgaaaactgagtgtccaggaagaaattactgtaaatgttgcaaaa
aaattgatagaaatattaaatccattgggagttgctgttgtggttgaggcacggcatatg
tgtattgaaatgagagggattaataagattggttcagttactaaaacgtcgttttatagt
ggagaatttaaggtgaatgtggataggaagaaggagtttttggatgggataaaataa

DBGET integrated database retrieval system