KEGG   Leptotrichia buccalis: Lebu_1250Help
Entry
Lebu_1250         CDS       T00975                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lba  Leptotrichia buccalis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lba00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1336264..1336749)
Genome map
AA seq 161 aa AA seqDB search
MKNKVYLSLGSNIGNRQEYIESAIELVGKTEGIKILKKSGLYETSPVGYVEQDLFLNAVI
KIETDFSAREILKIINKIENELDRKREIRWGPRTIDIDILIFSDKKINETDLIIPHKEML
NRLFVLVPLIEIYDGEYFEKEKIIERIEELVAVGNQKIEKL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaggtttatttgagtttgggaagtaatattggaaatagacaggaatatata
gaaagtgctattgaattagttgggaaaactgaaggaattaaaatattgaaaaaatctgga
ttatatgaaacaagtccagttggatatgtggaacaggatttatttttgaatgcagtaatt
aaaattgaaactgatttttcagcaagagaaattttaaaaattattaacaaaatagaaaac
gaattagatagaaaaagagaaatcagatggggacctagaacaattgatattgatatttta
attttttcagataaaaaaataaacgaaacagacttgataattccgcataaagaaatgttg
aatcggttgtttgtattggttccattaattgaaatttacgatggggaatattttgaaaaa
gaaaaaattattgaaagaatagaggaattagtggcagttggaaatcagaaaatagaaaaa
ttgtaa

DBGET integrated database retrieval system