KEGG   Leptotrichia buccalis: Lebu_1493Help
Entry
Lebu_1493         CDS       T00975                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lba  Leptotrichia buccalis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lba00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Lebu_1493
  Lipid metabolism
   00561 Glycerolipid metabolism
    Lebu_1493
   00600 Sphingolipid metabolism
    Lebu_1493
Enzymes [BR:lba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Lebu_1493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1574283..1576514)
Genome map
AA seq 743 aa AA seqDB search
MIKFNEKNREFHLYNEKISYVIGLLQNEQLGQYYFGKRIRHKDNFSHMFQRHKVEPSITP
SVDGKGFTLDAIKQEYPVYGTSDYREPALSILQENGSRITNFVYKSHKIIDGKPQLKGLP
AVYANTNDKVQTLEITLEDEVIQTELILSYTIFEEYPVILRNARIVNNGAEEINIEKIMS
LSLDLPDSDYMIMQLSGSWARERHIIEREAKRGITLIDSKRGTSSALNNPFIGLRRKNAT
ETEGEIIGLNLIYSGNFSAAVEVDQFDVTRLNIGINHFDFNWCLESGEEFQSPEAVLVYS
DEGINGMSNTFHNLYKDNLIRGKFKNKTRPILLNSWEGVYFDFNEEKILKMAEGAKDLGV
ELFVLDDGWFGTRDDDFQGLGDWDVNLAKLPNGIKGLAEKINEMGLKFGLWFEPEMVNKN
SNLYREHPDWILSTPQRHETQSRNQHYLDLSRPEVAEYVYESVAKNLRQANIEYVKWDMN
RTMTEVFSYGREAKRQKETWHRYFLGLYSVLERLVTEFPDVLFESCASGGNRFDAGMLYY
MPQTWTSDNSDAIDRLKIQYGTSIVYPVPAMGAHVSITPNHQTGRNTSLDIRGNVAMFGT
FGYELNPKDLSEAEKGEIRIQIEEFKGYRELMTAGDFYRVKSPFDGNEVAWLMVSKDKKE
AVVGYYRILMPVNNGLRRVRLTGLNPEFDYKVEKKKANSSKKIEFEKVGGDELMNFGLLV
GTNDEHRNIEGDFYTELYHLKSE
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgataaaatttaatgagaaaaacagagaatttcatttatacaacgaaaaaataagttat
gtaataggattgcttcaaaatgagcagctaggacaatattattttggaaaaagaataaga
cataaagataatttttcacatatgtttcagcgacataaagtagagccgtcaataactccg
tcagtagatggaaaagggttcacgctggatgcaataaaacaggaatatcctgtttatggt
acaagtgactatagagagcctgcattgtcgattttacaggaaaatggaagcagaattaca
aactttgtttataaaagtcataaaattatagatggaaaacctcagttaaaagggcttcca
gcagtttatgcaaatactaatgataaggtgcagactttggaaattacattggaagacgaa
gttattcagacagagttgatactaagttacacgatatttgaagaatatcctgtaatattg
agaaatgcaagaattgtaaataatggagcagaagaaataaatatcgaaaaaataatgagt
ctttcgcttgatcttccagattctgattatatgataatgcagcttagcggttcgtgggca
agagagcgtcacataatagagcgtgaggcaaaaagaggaataactctgattgacagtaaa
agaggaacaagcagtgccttaaacaatccatttattgggctaagaagaaagaatgcgact
gaaacagaaggagaaataattggactgaatcttatttacagcggaaatttttcagcggca
gtagaagtcgatcagtttgatgttacaagactgaatatcggaataaatcattttgatttt
aactggtgccttgaatctggagaagaatttcagtcgccagaagcggtgttagtctattca
gatgaaggaataaatggaatgagcaatactttccataatttatacaaggacaatctgata
agagggaaatttaagaataaaacacgtccaatacttttaaacagctgggaaggcgtatac
tttgactttaatgaggaaaaaatactgaaaatggcagaaggtgcaaaagatttgggagtg
gagctatttgtactagatgatggatggtttggaactagggatgatgattttcagggactt
ggagattgggatgtaaatttagcaaaattgcctaatggaattaaagggctagctgaaaag
ataaacgaaatgggacttaaatttgggttatggtttgagcctgaaatggtaaataagaac
agtaacctttatcgagaacatcctgactggattctatcaactccccaaaggcatgaaaca
cagtcaagaaatcagcattatttagatttatcaaggccagaagttgcagaatatgtttat
gaatctgtagccaaaaacttgagacaagcaaatattgaatatgtaaaatgggatatgaac
agaacaatgacggaagtattttcatacggaagagaagcaaaaagacagaaagaaacatgg
cacagatattttttagggctttattcggttttagaaagactggttacagaatttccagat
gtactgtttgaatcgtgtgcaagtggaggaaatagatttgatgcgggaatgctttactat
atgcctcaaacttggacaagtgacaatagtgatgcgatagacagattaaaaatacaatat
ggaacttcaattgtatatccagtgccagcgatgggagcacacgtttcgattactccaaat
catcagacaggaagaaatactagccttgatataagaggaaatgtggcaatgtttggaaca
tttggatatgaactcaatccaaaagatttgtcggaagctgaaaaaggtgagattagaata
caaattgaggaatttaaggggtatcgtgagttaatgacggctggagatttttatagagtg
aaatcgccttttgatggaaatgaagtggcatggcttatggtaagtaaggataaaaaagag
gcagttgttggatattacagaatacttatgcctgtaaataacggattgcgaagggtaagg
cttacaggacttaatccagaatttgattataaagttgaaaagaaaaaggcaaattcttct
aaaaagattgaatttgaaaaagttggcggagatgagcttatgaattttggacttttagtt
gggacaaatgatgagcatagaaatattgaaggagatttttatactgaattgtatcattta
aagtctgaataa

DBGET integrated database retrieval system