KEGG   Leptotrichia buccalis: Lebu_1529Help
Entry
Lebu_1529         CDS       T00975                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
lba  Leptotrichia buccalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lba00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Lebu_1529
Enzymes [BR:lba01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Lebu_1529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1615208..1616698
Genome map
AA seq 496 aa AA seqDB search
MFERSSGILLHPTSLPGKYGIGSLGKEAYKFVDFLKKANQRLWQIFPLGPTGYGDSPYQC
FSTFAGNPYLIDFDLLIEQNLLAEEDLKGVDFGGNEEYIDYGAIYNQKYPLLRKAYENFK
ANENKELKEKLETFKAENSSWLDDYSLYISLKNHFNGLPWNEWEDDIRTRKEAAINKYKA
ELADEIEYNNFIQFLFFTQWNNVKKYANDNGIKIIGDIPIFVAVDSSDAWANPEIFLFDP
ELKPVKVAGVPPDYFSATGQLWGNPLYDWDKLKELNYKWWVDRVKANLSTCDIIRIDHFR
GFDEYWAVPYGDKTAENGTWCPGPRTDLFNTIKNELGELPIIAEDLGTMTQGVIDLREAT
GFPGMKILGFAFDSKEENDYLPHTYTKNCVVYTGTHDNDTLIGWFTKANEDDKQFARNYL
NSRSDNEIHWDAIRGAWSSVANMAIAPIQDFLGLGSEARINTPGLASGNWQWRLKDGVLT
DELAERIAKLTKVYSR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagagaagttctggtattttgttacatcctacttcacttcctggaaaatatgga
attggaagtttagggaaagaagcatataaatttgtagatttcctaaaaaaagcaaatcag
agattatggcaaattttcccacttgggccgactggatatggtgattcaccttaccaatgt
ttttcaacatttgctggaaacccatatttaattgattttgacttattaatcgagcaaaat
ttattagctgaggaagatttgaaaggtgttgattttggaggaaatgaagaatatattgat
tatggcgctatttataatcaaaaatatcctttactaagaaaagcatatgaaaattttaaa
gctaatgaaaataaagaattaaaagaaaaattggaaacttttaaagctgaaaatagctct
tggctagatgactacagcctttatatttccttgaaaaatcactttaatggacttccttgg
aatgaatgggaagatgacatcagaactagaaaagaagctgctataaataaatacaaagct
gaattagctgatgaaatcgaatataataattttattcagttcctattctttactcaatgg
aataacgtaaaaaaatacgctaatgacaatggaataaaaataatcggagatataccaatc
ttcgttgcagtagacagctcagacgcatgggcaaatccagaaattttcctattcgatcct
gaactaaaacctgttaaagtagctggtgttccgcctgattatttcagtgccacaggacaa
ctttggggaaatcctttgtacgactgggacaaattaaaagagttaaactacaaatggtgg
gtagacagagttaaagccaacctttccacttgcgacatcataagaattgatcacttcaga
ggatttgatgaatattgggctgttccttatggagataaaacagctgaaaatggtacttgg
tgtccagggcctagaacagacttatttaacaccattaaaaatgaacttggagaattacct
ataattgctgaagatttaggaacaatgacgcaaggtgttattgatttgagagaagcaact
ggattccctggaatgaaaattctaggatttgcatttgattccaaagaagaaaatgactac
ttgcctcatacttataccaaaaattgcgtagtttatacaggaactcatgataacgacaca
ttaattggatggtttacaaaagccaatgaagacgataaacaatttgcaagaaactattta
aattcaagatctgataatgaaatccattgggatgcgataagaggtgcatggagctctgtt
gcaaacatggcaatcgctccaattcaagatttcttaggattaggaagcgaagctagaatc
aatactcctggacttgctagcggaaactggcaatggagattaaaagatggtgtgttgaca
gatgaattagcagaaagaattgctaaattaacaaaagtttactcaagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system