KEGG   Leptotrichia buccalis: Lebu_1803Help
Entry
Lebu_1803         CDS       T00975                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lba  Leptotrichia buccalis
Pathway
lba00010  Glycolysis / Gluconeogenesis
lba00051  Fructose and mannose metabolism
lba01100  Metabolic pathways
lba01110  Biosynthesis of secondary metabolites
lba01120  Microbial metabolism in diverse environments
lba01130  Biosynthesis of antibiotics
lba01200  Carbon metabolism
lba01230  Biosynthesis of amino acids
Module
lba_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lba_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lebu_1803
   00051 Fructose and mannose metabolism
    Lebu_1803
   00562 Inositol phosphate metabolism
    Lebu_1803
Enzymes [BR:lba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Lebu_1803
Exosome [BR:lba04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Lebu_1803
  Exosomal proteins of bladder cancer cells
   Lebu_1803
  Exosomal proteins of melanoma cells
   Lebu_1803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Macro
Motif
Other DBs
NCBI-ProteinID: ACV39669
JGI: Lbu_1803
UniProt: C7NBY8
Position
complement(1885374..1886141)
Genome map
AA seq 255 aa AA seqDB search
MRKVIVAGNWKMNKTAKEAAQFFNELKPLVADVKNAGIVIGAPFTALETATRETAGSNIK
IAAENMNAKESGAYTGEVSPLMLKDLGVEYVILGHSERREYYHETDEIINEKVKSALAHD
LKPILCIGEKLEEREAGTTNDVVKTQIVGGLKDVTAAEMANVVLAYEPVWAIGTGKTATP
EQAQEVHAFIRGLLTDLYGKEVAENVTVQYGGSMNDANAADLIAQTDIDGGLVGGASLIP
EKFAVIIKAGDAAAK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagtaatagtagctggaaactggaaaatgaacaaaactgcaaaagaggctgca
caattcttcaatgaattaaaacctttagtagcagatgtgaaaaatgcaggaatcgtaatc
ggagcgcctttcactgcattagaaacagcgactagagaaactgcaggaagcaacattaaa
atcgctgctgaaaatatgaacgctaaagaaagcggagcatatactggagaagtttcacca
ttgatgttaaaagatttaggtgtagaatatgtaattttaggacactctgaaagaagagaa
tattaccatgaaactgatgaaatcatcaatgaaaaagtaaaatcagcattagcgcacgat
ttgaaaccaatcttatgtattggggaaaaattggaagaaagagaagctggaactactaat
gatgttgtgaaaactcaaattgttggtggattaaaagatgttacagccgctgaaatggca
aacgttgtacttgcatatgaaccagtatgggcaattggaacaggtaaaactgccactcca
gaacaagctcaagaagttcacgcattcatcagaggattattaactgacttatatggaaaa
gaagttgcagaaaacgtgacagttcaatatggtggatcaatgaacgacgcaaatgcagct
gacttaatcgctcaaacagacattgacggtggattagtaggaggagcaagtttaattcct
gaaaaattcgctgtaataataaaagccggagatgcagcagctaaataa

DBGET integrated database retrieval system