KEGG   Leptotrichia buccalis: Lebu_1823Help
Entry
Lebu_1823         CDS       T00975                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
lba  Leptotrichia buccalis
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:lba00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1918361..1919212)
Genome map
AA seq 283 aa AA seqDB search
MRNKNIHTFIGCDNEYNESKIAIFGAPFDSTTSFRPGTRFASAVMRNESFGIETYSPYQD
KDLEDIKVFDGGDLELSFGNSESTLQDIQDETAKILKDGKIPFMIGGEHSVTLGAVKAVA
EKYPDLHIIQFDAHTDLRDEYLGQYYSHASVIRRCWDIVGDDRIFQFGIRSGERDEWKFA
KEHLHTTKFNFDGLDEVVEKLKGKPVYFTLDLDVLDPSEFPGTGTPEAGGVTFVELHKAI
EKISQLNIVGLDMNELSPVYDQSGQSTALACKLLREILLFIYK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagaaataaaaatatacatacatttataggttgtgacaatgaatacaatgagagcaaa
attgctatttttggagcgccgtttgacagtacaacttcgtttagaccagggactagattt
gcttcggcggttatgagaaatgagagttttgggatagaaacttatagcccttatcaggat
aaagatttggaagatattaaagtttttgacggcggggacttggagctttcgtttggaaat
tcggaaagtacattgcaggatattcaggatgaaacagcaaaaattttgaaggatgggaaa
attccgtttatgattggtggagagcattctgttacactgggggctgtgaaagcggttgct
gaaaaatatccagatttgcatattatacagtttgacgcacatacagatttgagagatgag
tatttaggacagtattattcacatgcttctgtaattagaagatgttgggacattgttgga
gatgacagaatctttcagtttggaataagaagcggcgaaagagatgaatggaaatttgca
aaggaacatcttcatacaacaaaatttaattttgatggacttgatgaagttgtagaaaaa
ttaaaagggaaacctgtgtattttacattggatctagatgtacttgatccatcggaattt
cctggaactggaacgcctgaagctggaggagttacttttgtggaacttcataaggcaata
gaaaaaatttcgcagttaaatattgttggacttgatatgaacgaattatcacctgtttac
gatcagtctggacaatctacagcattagcttgcaaactgcttagggaaattttgctattt
atttataaatag

DBGET integrated database retrieval system