KEGG   Leptotrichia buccalis: Lebu_1980Help
Entry
Lebu_1980         CDS       T00975                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lba  Leptotrichia buccalis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Lebu_1980
Enzymes [BR:lba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Lebu_1980
Exosome [BR:lba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Lebu_1980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2100051..2101049
Genome map
AA seq 332 aa AA seqDB search
MKKGETVMFKRHRKLRKNEVIRNLVKDVYIAKEDLIYPIFIEEGENIKNEILSMPGIFRY
SIDRLSEELDELVKLGINSILLFGIPKNKDTCATEAYNENGVIQNAVRFIKKKYNNFLVI
CDICCCEYTSHGHCGILDENGYVKNDETLEVLAKTALSYARAGADIVAPSDMMDGRVEKI
SKVLAENNFENIPIMAYSVKYSSAFYGPFRDAADSAPQFGDRKSYQMNFQYSKDAIDEVV
EDLRQGADIIIVKPAMAYLDVIKKVSDKFEIPIVAYSVSGEYSMVKAAAQNGWIDEMKIV
MEQMYAMKRAGANAIITYYAKEVAKFLENSEN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtgaaacagtaatgtttaaaagacatagaaaattacgtaaaaatgaagtg
ataagaaatcttgtaaaggatgtttacattgcaaaagaagatttgatttatcctattttc
attgaagaaggtgaaaatattaaaaacgagattctgtcaatgcctggaatttttagatat
tcaattgacaggctttcggaggaactggatgagctggtaaaattgggaataaattcgatt
ttgctttttgggattccaaaaaataaggatacctgtgcgacagaggcttataatgagaat
ggtgttatccaaaatgcagtcagatttataaagaaaaaatataataattttcttgtaatc
tgcgatatttgctgctgtgaatacacaagccacggacattgcgggatacttgatgaaaat
ggatatgtaaaaaatgatgaaacattggaagttttggcaaaaacagcactttcttatgca
agagcaggagcagatattgtggctccttctgatatgatggatggacgtgtagaaaaaatt
tccaaagttctagctgaaaataattttgaaaatattccaataatggcatattcagtaaaa
tattcatcggcattttatggaccgtttcgagatgcagcagattccgctcctcagtttggc
gacagaaaatcgtatcagatgaactttcaatattcaaaggatgcaatagatgaagttgtt
gaagacttacgacaaggagcggatattataattgtgaaacctgcgatggcgtatcttgat
gtaataaaaaaagtaagtgataaatttgaaattccaatcgtggcttacagtgtttcaggc
gagtattcaatggtaaaggcggcagctcaaaatggctggattgatgaaatgaaaattgta
atggagcagatgtatgcgatgaaaagggctggagcaaatgcaattattacatattatgct
aaagaagtagccaaatttttggaaaattctgaaaactaa

DBGET integrated database retrieval system