KEGG   Leptotrichia buccalis: Lebu_2043Help
Entry
Lebu_2043         CDS       T00975                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lba  Leptotrichia buccalis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lebu_2043
   01230 Biosynthesis of amino acids
    Lebu_2043
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lebu_2043
  Energy metabolism
   00680 Methane metabolism
    Lebu_2043
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lebu_2043
Enzymes [BR:lba01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Lebu_2043
Exosome [BR:lba04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Lebu_2043
  Exosomal proteins of melanoma cells
   Lebu_2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2166341..2167027
Genome map
AA seq 228 aa AA seqDB search
MKLVLIRHGESQWNLENKFTGWKDVDLSPKGIEEAKSGGKKLKEMGFVFDVAYTSYLKRA
IKTLDYVLEELDELYIPVYKSWRLNERHYGALQGLNKAETAKKYGDEQVLIWRRSFDVAP
PAIDKSSEYYPKSDRRYAELSDSEAPLGESLKDTIARVLPYWHSHISKSLREGKNVIVAA
HGNSLRALIKYLLNISDDDILKLNLTTGKPLVFEMDKDLNVLSSPDSF
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagttttaattagacatggtgaaagtcaatggaatttggaaaacaagtttact
ggatggaaggatgtggatttgagtccgaaaggaattgaagaagcaaaatctggtggaaaa
aaattaaaggaaatgggatttgtttttgatgtggcttatacatcttatttgaaaagagca
ataaaaactttggattatgttctggaagaactggatgagttgtatattccagtttacaag
tcatggagattgaatgaacgtcattacggtgcattgcaaggtttaaataaagctgaaaca
gctaagaagtatggagatgagcaagtgcttatctggagaagaagctttgatgtggcacca
cctgcaatagataaatcaagtgaatattatccaaaatcagacagaagatatgctgaatta
tctgattcagaagcaccgttaggagaaagtctgaaagacactattgcaagagttttacct
tactggcactcacacatttcaaaaagcctgcgggaaggaaaaaatgttattgtggcagct
catggaaacagtttaagagctttaatcaaatatttattaaatatttcagatgatgatatt
ttaaaattaaacttaactactggaaaacctttggtatttgaaatggataaggatttaaat
gtattgtcatcgccagattcattctag

DBGET integrated database retrieval system