KEGG   Leptotrichia buccalis: Lebu_2076Help
Entry
Lebu_2076         CDS       T00975                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lba  Leptotrichia buccalis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lba00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Lebu_2076
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lebu_2076
   00620 Pyruvate metabolism
    Lebu_2076
   00650 Butanoate metabolism
    Lebu_2076
  Lipid metabolism
   00071 Fatty acid degradation
    Lebu_2076
  Amino acid metabolism
   00350 Tyrosine metabolism
    Lebu_2076
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Lebu_2076
   00626 Naphthalene degradation
    Lebu_2076
Enzymes [BR:lba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Lebu_2076
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Lebu_2076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2208349..2210976
Genome map
AA seq 875 aa AA seqDB search
MAVVKDLESLKELIQRVRKAQEEFATFDQERVDKIFRKVAQKMNDERITLANLAVAETGM
GIVEDKVIKNHFASEYIYNKYKDEKTCGVLEDDRSYGVKKIATPIGIIAGIVPTTNPTST
AMFKTLISLKTRNAIIFSPHPRAKQATIETAKIALETAVKYGAPKDIIGWIDEPSVELSR
ELMASADLILATGGPGMVKAAYSSGTPAIGVGAGNTPVVIDKSADIKMTANYILMSKTFD
NGVICATEQSVIIDKEIYDKVRSEFLNRGAYILNEEELNKVREILFINGNLNAEVVGKSA
YVIAGMAGFEIPKSSKVLIGEVESTATEEPFAHEKLSPVLAMYKSENFEDSLKKADELVR
LGGLGHTSSLYINLAEKEKIDKFGRLMKTGRTLINMPASLGAIGDVFNFKLEPSLTLGCG
SWGGNSVSENVGVKHLLNVKTIAERRENMLWFKVPEKIYFKYGSLPTALEELKGSHKKAF
IVTDKVLAELGYAEHITKVLDEINIDYRIFSEVKEDPTLSSAQAGAKAMLEYNPDVVIAL
GGGSAMDAAKIMWVLYEHPELRFRDLAMRFMDIRKRIVEFPEMGKKAKFIAVATSAGTGS
EVTPFSVITDDETGIKYPLADYALTPHVAINDPELMLTMPKGLTIASGIDVFTHALESYV
SIMATEYTKPYSKEAARLVFKYLPESVDLGAKAIKAKEKMANASCLAGMAFANAFLGINH
SLAHKLGGKFHVPHGIANAMLLEEVIRFNAVEAPTKMGLFPQYRYPDAMQRYAEMNDYLG
FGGNTKEEKVENLIKGINELNRRIGIPASIKEWGVPEKDFLEAVDEMSLDAFDDQCTPAN
PRYPLMEELREIYLKSYYGKEWENEKERVAQILGF
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagtgaaagatttggaaagtttgaaggagcttattcagagagttagaaaggct
caggaggaatttgcaacatttgatcaagaaagagtcgataagatttttagaaaagtggct
caaaaaatgaatgatgaaagaattacactggcaaatctggcagtagcagaaactggaatg
gggattgtggaagacaaggttataaaaaatcactttgcttctgaatacatttacaataaa
tacaaagatgaaaaaacttgtggcgtgctggaagacgacagatcctacggagtcaaaaaa
attgcaactccaatagggattatcgcagggattgtaccaacaacaaatccaacttcaaca
gcaatgttcaaaacattaatatcattaaaaacaagaaatgcaataatattttctccacat
ccaagagcaaaacaagcaacaattgaaacggctaaaattgctttggaaacagcagtaaaa
tatggagcccctaaagacataatcggatggattgacgagccaagtgtagaattatcgaga
gaacttatggcaagtgctgatttgatacttgcgacaggtggaccaggaatggttaaggct
gcttattcatcaggaactcctgcaattggggtaggagctggaaatacaccagttgtaatt
gataaatcagcagatataaaaatgactgcaaactatattttgatgtctaaaacatttgat
aatggggtaatttgtgcgacagaacagtctgtaattatagacaaagaaatttacgacaaa
gttagaagcgaatttttaaacagaggagcttatatccttaacgaagaagaattaaataaa
gtaagagaaatattgtttataaatggaaacttgaatgctgaagtagttggaaaaagtgca
tatgttatcgcaggtatggcagggtttgaaattccaaaaagttcaaaagtgttaattggg
gaagtggaatctactgcaacagaagaaccttttgcacatgaaaaattatcgccagtgctt
gcaatgtacaaatctgaaaattttgaagattcactgaaaaaagctgatgagttagtaaga
cttggaggattaggacatacttcttcattgtatattaatttagcagaaaaagaaaaaata
gataaatttggaagattaatgaaaacaggacgtacattaattaatatgccagcgtcactt
ggagcaatcggagatgtatttaactttaaattagagccatcattaacacttggatgtggt
tcatggggaggaaattctgtgtcagaaaacgtaggagtaaaacatttattaaatgtaaaa
acaattgcagaaagaagagaaaatatgttatggttcaaagttcctgaaaaaatttatttc
aaatacggatcacttccgacagctttagaagaattgaaaggaagccacaaaaaagcattt
atcgtaacagataaagtattggcagaattaggatatgcagaacacattacaaaagtattg
gatgaaataaatattgattatagaatattctctgaagtaaaagaggatccaacattaagt
tcggctcaggctggagcaaaagcaatgcttgaatacaatcctgacgttgttatcgctctt
ggtggaggatctgcaatggatgccgctaaaattatgtgggtattatacgaacatcctgaa
ttaagatttagagatttggcaatgagatttatggatattagaaagagaatcgttgaattt
cctgaaatgggtaaaaaagctaaatttatcgcagttgcaacatcggctggaactggttcg
gaagtaactccattctcagtaattacagatgatgaaactggaattaaatacccgcttgca
gattatgcattaacaccgcatgtagcaattaacgatcctgagcttatgctcacaatgcca
aaagggcttacaatagcttctggaattgacgtatttacacatgctcttgaatcttatgtt
tcaattatggcaacagaatatacaaaaccatattcaaaagaagcggctagacttgtattc
aaatacttgccagaatcggtagatttaggtgcaaaagcaattaaagctaaggaaaaaatg
gctaatgcttcatgtcttgcaggaatggctttcgcaaatgcattcttaggaataaatcac
tcgcttgcacacaaacttggaggaaaattccacgtgccacatggtattgcaaatgctatg
cttcttgaagaagttatccgtttcaatgcagttgaggctccaacaaaaatgggattattc
cctcaatacagatatcctgacgcaatgcaaagatacgctgaaatgaatgattatctagga
tttggcggaaacactaaagaagaaaaagtggaaaatttaattaagggaattaatgaatta
aatagaagaattggaattccagcaagcattaaggaatggggagtgcctgaaaaagacttc
ctggaagcagtagacgaaatgtcactagatgcttttgatgaccaatgtacaccagctaac
ccaagatacccgctaatggaagaattaagagaaatttacttaaaatcttactacggaaaa
gaatgggaaaatgaaaaagaaagagtagcacaaattttaggtttttaa

DBGET integrated database retrieval system