KEGG   Leptotrichia buccalis: Lebu_2237Help
Entry
Lebu_2237         CDS       T00975                                 

Definition
glycoside hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lba  Leptotrichia buccalis
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lba00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2383202..2384635)
Genome map
AA seq 477 aa AA seqDB search
MTEKKFPEEFLWGGATAANQLEGAYNEGGKGLSVQDVTPRGGANVGGEVLITKEPTEDNL
KLKGIDFYHKYKEDIALFAEMGFKVFRISIAWSRIFPKGDELEPNEEGLKFYDNLFDEMA
KYEIEPLVTLSHYETPLHLAREYNGWTNRKLIEFFERYARTVFERYKDKVKYWLTFNEIN
SVLHAPFISGGIPTDGEMKPTKQELYQAVHNELVASALVTKIGHEINPDFKIGCMILSMP
AYPMTSHPLDSLAAREFERENYLFADVHVRGKYPTYAKRYFRENGINIEFAEGDEKLLAE
NPVDFMSFSYYVSVAAAHNPQDYQSGKGNLLGGLKNPYLETSEWGWQIDPVGLRIVLNDF
YDRYQIPLFIVENGLGAKDVLVDGPNGPTVGDDYRIDYLRKHLEQVKEAIEDGVEVMGYT
SWGCIDLVSSSTAEMSKRYGYIYVDRNDDGTGSLNRYKKKSFYWYKKVIESNGEDLS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaaaaaatttccagaagaatttttatggggaggagctactgctgcaaatcag
cttgaaggagcatataatgaaggtgggaaaggattatcagtgcaagatgtaacgccgaga
ggcggtgcaaatgttggtggagaagtgttaattacaaaagagccaacagaagacaatttg
aaattaaaagggattgatttttatcacaaatataaagaagacatagctttatttgcagaa
atgggatttaaagtatttagaatttcgattgcctggagcagaatttttccaaaaggggat
gaattggagccaaatgaagaagggctaaaattttatgataacttatttgatgaaatggca
aaatatgaaattgagccacttgtaacattgtcccattatgaaacgccgcttcatttagca
agagaatataatggatggacaaatagaaaattaattgaattttttgaaagatatgctcgt
acagtgtttgaaagatataaagataaggtaaaatactggttgacatttaatgagataaat
tctgttttacacgctccatttataagtggtggaattccaaccgatggagaaatgaaaccg
actaaacaggaattgtaccaagctgtccacaatgaattagtcgcttcagcattagtcaca
aaaattgggcacgaaattaatccagattttaaaataggatgtatgattttatcaatgcca
gcttatccaatgacatcacatccgcttgattcattggctgcaagagaatttgaaagagaa
aattatctgtttgcagatgtgcatgtaagaggaaaatatccaacttatgcaaaaagatac
tttagagaaaatggtataaatattgaatttgctgaaggtgatgaaaagttgttagctgaa
aatccagttgattttatgtcgttctcgtattatgtgagtgttgcagcggcacataatcca
caagattatcaaagtggaaaaggtaatttattaggtggattgaaaaatccatatttagaa
acaagtgaatggggttggcaaattgacccagttgggcttagaattgtgttaaatgatttt
tatgacagataccaaattccattatttattgtagaaaatggacttggagcaaaagatgtt
ttagttgacggacctaatggaccaacagttggagatgattacagaattgactatttgaga
aagcatttggaacaagtaaaagaagcgattgaagatggagtggaagtaatgggatatact
tcttggggctgtattgacttagtttcatcttcaacagctgaaatgagtaaaagatatggc
tatatctatgttgacagaaatgatgatggaactggttcattaaatcgttataaaaagaaa
tcattttactggtataaaaaagtaattgaaagcaatggagaagatttgagttaa

DBGET integrated database retrieval system