KEGG   Laccaria bicolor: LACBIDRAFT_147162Help
Entry
LACBIDRAFT_147162 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
lbc  Laccaria bicolor
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    LACBIDRAFT_147162
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LACBIDRAFT_147162
Peptidases [BR:lbc01002]
 Metallo Peptidases
  Family M67
   LACBIDRAFT_147162
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 175 aa AA seqDB search
LKNVSLPRECLPRFLAIASLNTLANRETCGLLLGKDKGHRYSVTTLLIPKQHATSDTCTM
DEEELVMQFTEERSLITLGWIHTHPSQSCFMSSVDLHTHSGFQRMLPESFAVVCAPNSNP
NFGIFRLTDPPGLTTVLECTVKEAFHPHPDLPIYTDADKGHVQMKDSSLEIVDLR
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
ctgaaaaacgtcagtcttccacgggagtgtcttccccgtttcttggccatagcgagtttg
aataccctggcgaatagggagacgtgtgggttgttgttgggcaaggataaggggcaccgg
tattcggttacgacgctgttgataccgaagcagcatgcgacgagtgatacgtgtactatg
gatgaggaggagttggttatgcagtttacggaggagaggagtttgattacgcttggatgg
atacatacgcatccttctcaatcatgttttatgtcttctgtggatttacatacccattct
ggatttcaacggatgttgccagagtcgtttgctgtcgtttgtgctcccaattcgaaccca
aactttggcatcttccgcttgaccgaccctccaggtcttacgactgttctagagtgtacc
gtgaaagaagcgtttcatcctcatcctgatttacccatatatacggacgcggataagggg
catgtgcaaatgaaagattcttctttggaaatcgtggatctccgc

DBGET integrated database retrieval system