KEGG   Laccaria bicolor: LACBIDRAFT_149371Help
Entry
LACBIDRAFT_149371 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
lbc  Laccaria bicolor
Brite
Exosome [BR:lbc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LACBIDRAFT_149371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 112 aa AA seqDB search
SAGKAPASTASKLPRPRRIDRWRKGSQEDTLADGEEEARDTRCESYSSYIYKGVHPDTGI
SKKAMAILKSFVNNIFKHIATEPSSTCHVGLRLSHSVFMLITSINFVLQDQI
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
tctgctggcaaagccccggcctccaccgcttccaaacttccaaggccccgccgaattgac
agatggcgcaaaggcagccaagaagacacgctggctgatggagaagaagaagcgagagat
acaaggtgcgaaagttactcctcttacatctacaagggtgtccaccctgacactggtatc
tccaaaaaggcgatggctatccttaaaagcttcgtgaacaatatcttcaaacacattgct
actgaaccttccagtacatgccatgtaggtcttcgtctctcacattctgtatttatgtta
attacctccatcaattttgtattacaggatcaaatc

DBGET integrated database retrieval system