KEGG   Laccaria bicolor: LACBIDRAFT_170295Help
Entry
LACBIDRAFT_170295 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
lbc  Laccaria bicolor
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LACBIDRAFT_170295
Translation factors [BR:lbc03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    LACBIDRAFT_170295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 666 aa AA seqDB search
MPWDDATGKSKGFMFVEFRHVDDANLAIAALNGHPFDARHTFRVNYFTDIERYAGMDEAY
VEPELEDYVPREHLRAWLADPQSRDQYVTYRGEEVLINWHGKPSQGLVLNAFQDWKDFLY
VAWSPLGTYIATLHRQGVRLWGGSSWKPQQRFAHPMVKLIDFSPCEQYLVTWSNEPIVVP
EGALQGPQYFSPDDEGNNIAVWDIKSGDLLRTFSTFNDNDAPSSKKQMQWPALKWSPDDK
FVARITPGQMISVHELPGMYLHGKKSLKIEGVVDFEWCPQGDKDKEDLEKDAKVMASGSA
AKTSKKARENMLVYWTPEVANQPARVTLLGFPSRTILRQKNLFNVTECKLYWQNQGDFLC
VKVDRHTKTKKSIFCNLEIFRMREKDYPVEVVELKDTVLDFSWEPKGERFAIVSSSDPNL
GNPGPGVTTKTDVSFHQLEHGKNFKLLRTLPGRTSNAIRWSPRGRHVVLATVGSSSKSEL
EFWDLDFNSDDANRREGQNTDWGSGIQLLGTADHYGVTDVEWDPSGRYLATSASAWTHTL
ENGFAIWDFRGQELIKQIQDRFKQFIWRPRPISLLTKEKQRQVRKNLREYSRAFDEDDAA
EESSVSAELIALRKRLVDEWNAWRTLQKKELGEQKSLKSQTASEEKEEIEVWVDEVIEQI
EEEVVE
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgccatgggacgacgcaacgggaaagagcaaggggtttatgtttgtggaattccgccac
gtagatgacgcaaaccttgcaattgcggctctgaatgggcacccgttcgatgcgagacac
accttcagagtcaactacttcactgacattgagcggtatgcgggtatggatgaggcatat
gttgagccagaactcgaggactacgttccacgggaacatctccgcgcttggcttgcagac
cctcaaagccgtgatcagtatgtaacatatcgaggagaggaggttctgattaattggcat
ggtaaaccctcgcaaggcttagtgttgaatgcttttcaggattggaaggactttctctac
gtagcgtggtctcccttggggacctacattgcgactttgcatcgacaaggagtacgttta
tggggaggttcctcttggaagcctcagcagcggttcgcccatccgatggtgaagctcatc
gacttctctccctgcgagcaatatcttgtcacctggtctaacgagcctatcgttgtccca
gagggagctttgcaaggtccccaatacttctcgcctgacgatgaaggcaacaacattgct
gtatgggatataaaatcaggcgatcttctcagaacattttccacatttaacgacaatgac
gctccatcatcgaagaaacaaatgcaatggcccgccctgaaatggagccccgacgataaa
tttgttgcacgcatcactccagggcagatgatcagtgttcatgaacttccgggcatgtat
ctccatggcaaaaaaagcttaaaaattgaaggcgtagtcgactttgagtggtgcccacaa
ggtgacaaggataaggaggacctggaaaaggacgctaaagtgatggcgagtggctctgct
gccaagacttcaaaaaaagctcgcgaaaacatgctggtttactggacccctgaagttgca
aatcagcccgcgcgcgttaccctccttggctttcccagtcgcaccattttgcgacagaag
aatttgttcaacgtcaccgaatgtaaactctactggcaaaatcagggcgatttcctttgt
gtcaaggtggatcgacatactaaaactaagaaatcgatcttctgtaacttggaaattttt
cggatgcgtgaaaaagattatcctgttgaagttgtcgaactaaaagacaccgttctggat
ttttcttgggagccgaagggcgagcgatttgccattgtttccagctctgatcctaacctt
ggcaatcctgggccgggagtgaccacaaaaacggatgttagcttccatcagttggaacac
ggcaagaatttcaaactcctacgtactttgcctggaaggactagcaatgcaatccgatgg
tccccgcgagggcgacatgtggttcttgcaactgttggatcctctagtaaatctgagttg
gaattttgggatttagacttcaattcggacgatgctaatcgaagagagggtcaaaacaca
gactggggcagtggtatccaactcctcggaactgccgaccactacggtgtaaccgacgtt
gaatgggatcccagtggccgttatttagccacgagtgctagtgcatggacacatacgctc
gaaaatggctttgcaatttgggacttccgtggacaagaactaataaaacaaattcaagac
agattcaaacaatttatctggcgaccacgcccgatcagcctattaacaaaagaaaaacag
agacaagttcgcaagaacctccgagagtacagtcgtgcattcgatgaagacgatgctgca
gaagagagcagtgtcagtgcggaactcattgcccttcgtaaacgactcgtggatgagtgg
aacgcatggcgcacacttcagaagaaggaactaggtgagcaaaagagcttgaaaagtcag
actgcgagcgaggaaaaggaggaaatcgaagtttgggttgacgaagtcattgaacagata
gaagaggaggttgtggaatag

DBGET integrated database retrieval system