KEGG   Laccaria bicolor: LACBIDRAFT_171534Help
Entry
LACBIDRAFT_171534 CDS       T01044                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
lbc  Laccaria bicolor
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LACBIDRAFT_171534
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     LACBIDRAFT_171534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 181 aa AA seqDB search
MAVAVRTILECIGEDPDREGLQRTPERYAQAIMWMTRGYEERLADVINDAVFAEDHDEMV
LVRDIDISSLCEHHLVPFTGKIAIAYIPNQLVLGLSKLARIAETFSRRLQVQERLTKQIA
IAVQEAIKPRGVAVVMEATHLCMTMRGVQKPGSITVTSCMLGCFRTQQKTREEFLTLIKS
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggccgtggccgtccgcacaatccttgaatgcatcggtgaagatcccgatcgtgaaggg
ctccaacgcacgccagagcgttatgcgcaagctattatgtggatgacacgaggatatgaa
gagagactagcagacgttatcaacgatgctgtttttgccgaagatcacgacgagatggtt
cttgtccgagacatagatatctctagtttgtgcgaacaccaccttgtaccgtttacagga
aaaatcgctatagcgtatatccccaaccaactagtattggggctttcgaagctcgcacgg
atagcggaaacctttagtcggcgattgcaagtacaagagcgtctcacgaaacagattgct
attgcggttcaagaagccatcaaaccccgcggagtggcagttgttatggaggcaacgcat
ctctgtatgaccatgcgtggcgtccaaaagcctggttcaatcaccgtaacatcttgcatg
ttgggatgcttccgcacacaacaaaagactagggaagaattcctcacactcatcaagagc
aagtaa

DBGET integrated database retrieval system